PRKD3 Antibody - middle region (ARP75491_P050)

Catalog No: ARP75491_P050

Click here to learn more about Aviva's By-Request Conjugation Service.

Host: Rabbit
Target Name: KPCD3
Sample Type: Fetal Liver lysates
Antibody Dilution: 1.0ug/ml

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of Human KPCD3
• Purification: Affinity purified
• Peptide Sequence: Synthetic peptide located within the following region: GEVTFNGEPSSLGTDTDIPMDIDNNDINSDSSRGLDDTEEPSPPEDKMFF
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-PRKD3 (ARP75491_P050) antibody is Catalog # AAP75491

Target Info

• Gene Symbol: PRKD3
• Gene Full Name: protein kinase D3
• Alias Symbols: EPK2, PKD3, PRKCN, PKC-NU, nPKC-NU
• NCBI Gene Id: 23683
• Protein Name: serine/threonine-protein kinase D3
• Description of Target: This gene belongs to the multigene protein kinase D family of serine/threonine kinases, which bind diacylglycerol and phorbol esters. Members of this family are characterized by an N-terminal regulatory domain comprised of a tandem repeat of cysteine-rich zinc-finger motifs and a pleckstrin domain. The C-terminal region contains the catalytic domain and is distantly related to calcium-regulated kinases. Catalytic activity of this enzyme promotes its nuclear localization. This protein has been implicated in a variety of functions including negative regulation of human airway epithelial barrier formation, growth regulation of breast and prostate cancer cells, and vesicle trafficking.
• Uniprot ID: O94806
• Protein Accession #: XP_005264294
• Protein Size (# AA): 890
• Molecular Weight: 97kDa
• Protein Interactions: SKA2; UBC; DLAT; NUDT3; HDAC5; BCL6; IKBKG; RAE1; GSK3A; KPNB1; KPNA2; VAMP2;