Search Antibody, Protein, and ELISA Kit Solutions

PRKCG Antibody - N-terminal region (ARP56425_P050)

100 ul

Regular Price: $319.00

Special Price: $229.00

In Stock
Request Bulk Order Quote

Conjugation Options

ARP56425_P050-FITC Conjugated

ARP56425_P050-HRP Conjugated

ARP56425_P050-Biotin Conjugated

Tested Species Reactivity:
Human, Mouse
Predicted Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality:
Polyclonal
Host:
Rabbit
Application:
WB, CHIP
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item:
This antibody may replace item sc-116200 from Santa Cruz Biotechnology.
Immunogen:
The immunogen is a synthetic peptide directed towards the N terminal region of human PRKCG
Purification:
Affinity Purified
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 85%
Complete computational species homology data:
Anti-PRKCG (ARP56425_P050)
Peptide Sequence:
Synthetic peptide located within the following region: FVVHRRCHEFVTFECPGAGKGPQTDDPRNKHKFRLHSYSSPTFCDHCGSL
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide:
For anti-PRKCG (ARP56425_P050) antibody is Catalog # AAP56425 (Previous Catalog # AAPP38734)
Datasheets/Manuals:
Printable datasheet for anti-PRKCG (ARP56425_P050) antibody
Target Reference:
Wieczorek,S., (2007) Mov. Disord. 22 (14), 2135-2136
Gene Symbol:
PRKCG
Official Gene Full Name:
Protein kinase C, gamma
Alias Symbols:
MGC57564, PKC-gamma, PKCC, PKCG, SCA14
NCBI Gene Id:
5582
Protein Name:
Protein kinase C gamma type
Description of Target:
Protein kinase C (PKC) is a family of serine- and threonine-specific protein kinases that can be activated by calcium and second messenger diacylglycerol. PKC family members phosphorylate a wide variety of protein targets and are known to be involved in d
Swissprot Id:
P05129
Protein Accession #:
NP_002730
Nucleotide Accession #:
NM_002739
Protein Size (# AA):
697
Molecular Weight:
78kDa
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express PRKCG.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express PRKCG.
Protein Interactions:
GFAP; EPHB1; ARHGEF25; TRIM5; RANBP10; RANBP9; SCN3A; HSPA4; ITGB2; HSP90AA1; GSK3A; CASR; Marcks; SDC2; APP; TOP2A; CCHCR1; IBTK; NOXA1; EXOC5; PICK1; DDX58; PRKCG; NFE2L2; UBC; OCLN; PARD6B; PPP1R14A; GRIN1; HABP4; AFAP1; MARK4; GABRA4; CHAT; PEBP1; PAR

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...