Search Antibody, Protein, and ELISA Kit Solutions

PRKCB Antibody - C-terminal region (ARP75059_P050)

100 ul
$289.00
In Stock
Request Bulk Order Quote

Gene Symbol:
PRKCB
Official Gene Full Name:
protein kinase C beta
NCBI Gene Id:
5579
Protein Name:
protein kinase C beta type
Swissprot Id:
P05771
Protein Accession #:
NP_997700.1
Nucleotide Accession #:
NM_212535.2
Alias Symbols:
PKCB, PRKCB1, PRKCB2, PKC-beta
Description of Target:
Protein kinase C (PKC) is a family of serine- and threonine-specific protein kinases that can be activated by calcium and second messenger diacylglycerol. PKC family members phosphorylate a wide variety of protein targets and are known to be involved in diverse cellular signaling pathways. PKC family members also serve as major receptors for phorbol esters, a class of tumor promoters. Each member of the PKC family has a specific expression profile and is believed to play a distinct role in cells. The protein encoded by this gene is one of the PKC family members. This protein kinase has been reported to be involved in many different cellular functions, such as B cell activation, apoptosis induction, endothelial cell proliferation, and intestinal sugar absorption. Studies in mice also suggest that this kinase may also regulate neuronal functions and correlate fear-induced conflict behavior after stress. Alternatively spliced transcript variants encoding distinct isoforms have been reported. [provided by RefSeq, Jul 2008]
Protein Size (# AA):
671
Molecular Weight:
73 kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity purified
Application:
WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express PRKCB.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express PRKCB.
Immunogen:
The immunogen is a synthetic peptide directed towards the C terminal region of human PRKCB
Predicted Species Reactivity:
Human
Tested Species Reactivity:
Human
Peptide Sequence:
Synthetic peptide located within the following region: GKRLGCGPEGERDIKEHAFFRYIDWEKLERKEIQPPYKPKARDKRDTSNF
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide:
For anti-PRKCB (ARP75059_P050) antibody is Catalog # AAP75059
Datasheets/Manuals:
Printable datasheet for anti-PRKCB (ARP75059_P050) antibody

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...