- Toll Free: 888-880-0001
- Phone: 858-552-6979
- Email: info@avivasysbio.com
- $55: Antibody & Protein in US
- $55 + $25/Kit in US
- Contact us for international orders.
Datasheets/Manuals | Printable datasheet for anti-PRKCA (OAAN00067) |
---|
Predicted Species Reactivity | Human |
---|---|
Product Format | LiquidPBS with 0.02% sodium azide, 50% glycerol (pH 7.3) |
Clonality | Polyclonal |
Isotype | IgG |
Host | Rabbit |
Conjugation | Unconjugated |
Application | WB, IHC, IF |
:: | Positive Samples: Jurkat, K-562 Cellular Location: Cell membrane, Cytoplasm, Mitochondrion membrane, Nucleus, Peripheral membrane protein |
Reconstitution and Storage | Store at -20C. Avoid repeated freeze/thaw cycles. |
Immunogen | A synthetic peptide corresponding to a sequence within amino acids 570 to the C-terminus of human PRKCA (NP_002728.1). |
Purification | Affinity purified against immunogen |
Application Info | WB: 1:500~2000 IHC: 1:50~200 IF: 1:50~200 |
Protein Sequence | KGLMTKHPAKRLGCGPEGERDVREHAFFRRIDWEKLENREIQPPFKPKVCGKGAENFDKFFTRGQPVLTPPDQLVIANIDQSDFEGFSYVNPQFVHPILQSAV |
Gene Symbol | PRKCA |
---|---|
Gene Full Name | protein kinase C alpha |
Alias Symbols | AAG6, PKCA, PRKACA, PKCI+/-, PKCalpha, PKC-alpha |
NCBI Gene Id | 5578 |
Protein Name | Protein kinase C alpha type |
Description of Target | Protein kinase C (PKC) is a family of serine- and threonine-specific protein kinases that can be activated by calcium and the second messenger diacylglycerol. PKC family members phosphorylate a wide variety of protein targets and are known to be involved in diverse cellular signaling pathways. PKC family members also serve as major receptors for phorbol esters, a class of tumor promoters. Each member of the PKC family has a specific expression profile and is believed to play a distinct role in cells. The protein encoded by this gene is one of the PKC family members. This kinase has been reported to play roles in many different cellular processes, such as cell adhesion, cell transformation, cell cycle checkpoint, and cell volume control. Knockout studies in mice suggest that this kinase may be a fundamental regulator of cardiac contractility and Ca(2+) handling in myocytes. |
Uniprot ID | P17252 |
Protein Accession # | NP_002728.1 |
Nucleotide Accession # | NM_002737.2 |
Molecular Weight | 76 kDa |
- Protocol:
- Reconstitution & Storage Instructions
- Western Blotting/Immunoblotting (WB/IB) Protocol
- Immunohistochemistry (IHC) Protocol
- Immunocytochemistry (ICC) Protocol
- Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol
- Blocking Peptide Competition Protocol (BPCP)
- Immunoprecipitation (IP) Protocol
- Antibody Array (AA) Protocol
- Tips Information:
-
See our General FAQ page.
-
What is the species homology for "PRKCA Antibody (OAAN00067)"?
The tested species reactivity for this item is "". This antibody is predicted to have homology to "Human".
-
How long will it take to receive "PRKCA Antibody (OAAN00067)"?
This item is available "Domestic: within 1-2 weeks delivery | International: 1-2 weeks".
-
What buffer format is "PRKCA Antibody (OAAN00067)" provided in?
This item is provided in "LiquidPBS with 0.02% sodium azide, 50% glycerol (pH 7.3)".
Additional format options may be available. For more information please contact info@avivasysbio.com. -
What are other names for "PRKCA Antibody (OAAN00067)"?
This target may also be called "AAG6, PKCA, PRKACA, PKCI+/-, PKCalpha, PKC-alpha" in publications.
-
What is the shipping cost for "PRKCA Antibody (OAAN00067)"?
The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.
-
What is the guarantee for "PRKCA Antibody (OAAN00067)"?
All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.
-
Can I get bulk pricing for "PRKCA Antibody (OAAN00067)"?
You can get bulk pricing for this item by going here.
-
What is the molecular weight of the protein?
The molecular weight reported by Uniprot for this item is "76 kDa".
Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics. -
What protocols are available for "PRKCA Antibody (OAAN00067)"?
We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.
-
What are positive controls for "PRKCA"?
We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.
-
What are negative controls for "PRKCA"?
We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.
-
What other proteins interact with "PRKCA"?
This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.
-
What biological processes are associated with "PRKCA"?
This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.
-
What cellular components are associated with "PRKCA"?
This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.
-
What protein functions are associated with "PRKCA"?
This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.