Catalog No: ARP56420_P050
Price: $0.00
SKU
ARP56420_P050
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.
Datasheets/ManualsPrintable datasheet for anti-PRKAR1B (ARP56420_P050) antibody
Product Info
Tested Species ReactivityHuman, Mouse
Predicted Species ReactivityHuman, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Sheep, Zebrafish
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of human PRKAR1B
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 92%; Human: 100%; Mouse: 100%; Rabbit: 85%; Rat: 100%; Sheep: 85%; Zebrafish: 100%
Peptide SequenceSynthetic peptide located within the following region: LNRPRAATVVARGPLKCVKLDRPRFERVLGPCSEILKRNIQRYNSFISLT
Concentration0.5 mg/ml
Blocking PeptideFor anti-PRKAR1B (ARP56420_P050) antibody is Catalog # AAPP38729
ReferenceZhan,X. (2006) Anal. Biochem. 354 (2), 279-289
Gene SymbolPRKAR1B
Gene Full NameProtein kinase, cAMP-dependent, regulatory, type I, beta
Alias SymbolsPRKAR1
NCBI Gene Id5575
Protein NamecAMP-dependent protein kinase type I-beta regulatory subunit
Description of TargetCyclic AMP-dependent protein kinase A (PKA) is an essential enzyme in the signaling pathway of the second messenger cAMP. Through phosphorylation of target proteins, PKA controls many biochemical events in the cell including regulation of metabolism, ion
Uniprot IDP31321
Protein Accession #NP_002726
Nucleotide Accession #NM_002735
Protein Size (# AA)381
Molecular Weight43kDa
Protein InteractionsUBC; DUS3L; THG1L; EEF2K; CALU; PRKACB; PRKACA; Dlg4; CUL3; WNK1; EGFR; PPP1R9A; WRN; SMAD3; AKAP1; SMAD4; PRKAR1A; PRKAR1B;
  1. What is the species homology for "PRKAR1B Antibody - middle region (ARP56420_P050)"?

    The tested species reactivity for this item is "Human, Mouse". This antibody is predicted to have homology to "Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Sheep, Zebrafish".

  2. How long will it take to receive "PRKAR1B Antibody - middle region (ARP56420_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "PRKAR1B Antibody - middle region (ARP56420_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "PRKAR1B Antibody - middle region (ARP56420_P050)"?

    This target may also be called "PRKAR1" in publications.

  5. What is the shipping cost for "PRKAR1B Antibody - middle region (ARP56420_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "PRKAR1B Antibody - middle region (ARP56420_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "PRKAR1B Antibody - middle region (ARP56420_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "43kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "PRKAR1B Antibody - middle region (ARP56420_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "PRKAR1B"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "PRKAR1B"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "PRKAR1B"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "PRKAR1B"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "PRKAR1B"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "PRKAR1B"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:PRKAR1B Antibody - middle region (ARP56420_P050)
Your Rating