- Toll Free: 888-880-0001
- Phone: 858-552-6979
- Email: info@avivasysbio.com
- $55: Antibody & Protein in US
- $55 + $25/Kit in US
- Contact us for international orders.
Datasheets/Manuals | Printable datasheet for anti-PRKAR1A (ARP57832_P050) antibody |
---|
Tested Species Reactivity | Human |
---|---|
Predicted Species Reactivity | Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Sheep, Zebrafish |
Product Format | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Clonality | Polyclonal |
Host | Rabbit |
Application | WB |
Reconstitution and Storage | For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Immunogen | The immunogen is a synthetic peptide directed towards the C terminal region of human PRKAR1A |
Purification | Affinity Purified |
Predicted Homology Based on Immunogen Sequence | Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Sheep: 100%; Zebrafish: 100% |
Peptide Sequence | Synthetic peptide located within the following region: MNRPRAATVVARGPLKCVKLDRPRFERVLGPCSDILKRNIQQYNSFVSLS |
Concentration | 0.5 mg/ml |
Blocking Peptide | For anti-PRKAR1A (ARP57832_P050) antibody is Catalog # AAPP34326 |
Gene Symbol | PRKAR1A |
---|---|
Gene Full Name | Protein kinase, cAMP-dependent, regulatory, type I, alpha (tissue specific extinguisher 1) |
Alias Symbols | CAR, CNC, CNC1, PKR1, TSE1, ADOHR, PPNAD1, PRKAR1, ACRDYS1 |
NCBI Gene Id | 5573 |
Protein Name | cAMP-dependent protein kinase type I-alpha regulatory subunit |
Description of Target | cAMP is a signaling molecule important for a variety of cellular functions. cAMP exerts its effects by activating the cAMP-dependent protein kinase, which transduces the signal through phosphorylation of different target proteins. The inactive kinase holoenzyme is a tetramer composed of two regulatory and two catalytic subunits. cAMP causes the dissociation of the inactive holoenzyme into a dimer of regulatory subunits bound to four cAMP and two free monomeric catalytic subunits. Four different regulatory subunits and three catalytic subunits have been identified in humans. This gene encodes one of the regulatory subunits. This protein was found to be a tissue-specific extinguisher that down-regulates the expression of seven liver genes in hepatoma x fibroblast hybrids. Mutations in this gene cause Carney complex (CNC). This gene can fuse to the RET protooncogene by gene rearrangement and form the thyroid tumor-specific chimeric oncogene known as PTC2. A nonconventional nuclear localization sequence (NLS) has been found for this protein which suggests a role in DNA replication via the protein serving as a nuclear transport protein for the second subunit of the Replication Factor C (RFC40). Three alternatively spliced transcript variants encoding the same protein have been observed. |
Uniprot ID | P10644 |
Protein Accession # | NP_997636 |
Nucleotide Accession # | NM_212471 |
Protein Size (# AA) | 381 |
Molecular Weight | 43kDa |
Protein Interactions | UBC; RAF1; MAPT; CEP250; GSK3B; AGO3; AGO2; ARPC3; PFDN5; DYRK1B; SET; DYRK1A; PLEKHF2; AKAP10; SOX2; PRKACB; PRKACA; NPM1; CAPN11; RFC2; PPP1CA; SMAD2; HIVEP1; SETD7; PRPF40A; CDK2; CCNE1; SMURF1; Akap7; MEN1; HSP90AA4P; SLC38A5; PRPF31; SAFB; UBD; PATZ1 |
- Protocol:
- Reconstitution & Storage Instructions
- Western Blotting/Immunoblotting (WB/IB) Protocol
- Immunohistochemistry (IHC) Protocol
- Immunocytochemistry (ICC) Protocol
- Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol
- Blocking Peptide Competition Protocol (BPCP)
- Immunoprecipitation (IP) Protocol
- Antibody Array (AA) Protocol
- Tips Information:
-
See our General FAQ page.
-
What is the species homology for "PRKAR1A Antibody - C-terminal region (ARP57832_P050)"?
The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Sheep, Zebrafish".
-
How long will it take to receive "PRKAR1A Antibody - C-terminal region (ARP57832_P050)"?
This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".
-
What buffer format is "PRKAR1A Antibody - C-terminal region (ARP57832_P050)" provided in?
This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
Additional format options may be available. For more information please contact info@avivasysbio.com. -
What are other names for "PRKAR1A Antibody - C-terminal region (ARP57832_P050)"?
This target may also be called "CAR, CNC, CNC1, PKR1, TSE1, ADOHR, PPNAD1, PRKAR1, ACRDYS1" in publications.
-
What is the shipping cost for "PRKAR1A Antibody - C-terminal region (ARP57832_P050)"?
The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.
-
What is the guarantee for "PRKAR1A Antibody - C-terminal region (ARP57832_P050)"?
All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.
-
Can I get bulk pricing for "PRKAR1A Antibody - C-terminal region (ARP57832_P050)"?
You can get bulk pricing for this item by going here.
-
What is the molecular weight of the protein?
The molecular weight reported by Uniprot for this item is "43kDa".
Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics. -
What protocols are available for "PRKAR1A Antibody - C-terminal region (ARP57832_P050)"?
We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.
-
What are positive controls for "PRKAR1A"?
We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.
-
What are negative controls for "PRKAR1A"?
We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.
-
What other proteins interact with "PRKAR1A"?
This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.
-
What biological processes are associated with "PRKAR1A"?
This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.
-
What cellular components are associated with "PRKAR1A"?
This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.
-
What protein functions are associated with "PRKAR1A"?
This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.