Catalog No: ARP56699_P050
Price: $0.00
SKU
ARP56699_P050
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.

PRKAB1 Antibody - N-terminal region (ARP56699_P050)

Datasheets/ManualsPrintable datasheet for anti-PRKAB1 (ARP56699_P050) antibody
Product Info
ReferenceHasumi,H., Gene 415 (1-2), 60-67 (2008)
Tested Species ReactivityHuman
Predicted Species ReactivityHuman, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human PRKAB1
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 93%
Peptide SequenceSynthetic peptide located within the following region: KILMDSPEDADLFHSEEIKAPEKEEFLAWQHDLEVNDKAPAQARPTVFRW
Concentration0.5 mg/ml
Blocking PeptideFor anti-PRKAB1 (ARP56699_P050) antibody is Catalog # AAP56699 (Previous Catalog # AAPP39509)
Subunitbeta-1
Gene SymbolPRKAB1
Gene Full NameProtein kinase, AMP-activated, beta 1 non-catalytic subunit
Alias SymbolsAMPK, HAMPKb
NCBI Gene Id5564
Protein Name5'-AMP-activated protein kinase subunit beta-1
Description of TargetThe protein encoded by this gene is a regulatory subunit of the AMP-activated protein kinase (AMPK). AMPK is a heterotrimer consisting of an alpha catalytic subunit, and non-catalytic beta and gamma subunits. AMPK is an important energy-sensing enzyme tha
Uniprot IDQ9Y478
Protein Accession #NP_006244
Nucleotide Accession #NM_006253
Protein Size (# AA)270
Molecular Weight30kDa
Protein InteractionsSNF4; SNF1; PRKAG1; PRKAA1; CIDEA; ACACA; APP; UBC; MAP3K7; MAPK6; GRB2; HDAC5; NSF; DSC1; CBR1; PRKAG2; CASP14; TGM3; PRKAB2; PRKAA2; NDUFA7; AGL; F10; PRKAG3; FNIP1; DHX36; SNRNP200; EZR; MYH10; MARS; GYS1; ACLY;
  1. What is the species homology for "PRKAB1 Antibody - N-terminal region (ARP56699_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit".

  2. How long will it take to receive "PRKAB1 Antibody - N-terminal region (ARP56699_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "PRKAB1 Antibody - N-terminal region (ARP56699_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "PRKAB1 Antibody - N-terminal region (ARP56699_P050)"?

    This target may also be called "AMPK, HAMPKb" in publications.

  5. What is the shipping cost for "PRKAB1 Antibody - N-terminal region (ARP56699_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "PRKAB1 Antibody - N-terminal region (ARP56699_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "PRKAB1 Antibody - N-terminal region (ARP56699_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "30kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "PRKAB1 Antibody - N-terminal region (ARP56699_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "PRKAB1"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "PRKAB1"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "PRKAB1"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "PRKAB1"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "PRKAB1"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "PRKAB1"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:PRKAB1 Antibody - N-terminal region (ARP56699_P050)
Your Rating
We found other products you might like!