Catalog No: ARP53846_P050
Price: $0.00
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.
Datasheets/ManualsPrintable datasheet for anti-PRKAA1 (ARP53846_P050) antibody
Product Info
ReferenceHasumi,H., Gene 415 (1-2), 60-67 (2008)
Tested Species ReactivityHuman
Predicted Species ReactivityHuman, Rat, Rabbit
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ApplicationWB, IHC
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human PRKAA1
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceHuman: 100%; Rabbit: 85%; Rat: 85%
Peptide SequenceSynthetic peptide located within the following region: GELFDYICKNGRKSDVPGVVKTGSTKELDEKESRRLFQQILSGVDYCHRH
Concentration0.5 mg/ml
Blocking PeptideFor anti-PRKAA1 (ARP53846_P050) antibody is Catalog # AAP53846 (Previous Catalog # AAPP30871)
Gene SymbolPRKAA1
Gene Full NameProtein kinase, AMP-activated, alpha 1 catalytic subunit
Alias SymbolsAMPK, AMPKa1, AMPK alpha 1
NCBI Gene Id5562
Protein Name5'-AMP-activated protein kinase catalytic subunit alpha-1
Description of TargetPRKAA1 belongs to the ser/thr protein kinase family. It is the catalytic subunit of the 5'-prime-AMP-activated protein kinase (AMPK). AMPK is a cellular energy sensor conserved in all eukaryotic cells. The kinase activity of AMPK is activated by the stimuli that increase the cellular AMP/ATP ratio. AMPK regulates the activities of a number of key metabolic enzymes through phosphorylation. It protects cells from stresses that cause ATP depletion by switching off ATP-consuming biosynthetic pathways.The protein encoded by this gene belongs to the ser/thr protein kinase family. It is the catalytic subunit of the 5'-prime-AMP-activated protein kinase (AMPK). AMPK is a cellular energy sensor conserved in all eukaryotic cells. The kinase activity of AMPK is activated by the stimuli that increase the cellular AMP/ATP ratio. AMPK regulates the activities of a number of key metabolic enzymes through phosphorylation. It protects cells from stresses that cause ATP depletion by switching off ATP-consuming biosynthetic pathways. Alternatively spliced transcript variants encoding distinct isoforms have been observed.
Uniprot IDQ13131
Protein Accession #NP_996790
Nucleotide Accession #NM_206907
Protein Size (# AA)565
Molecular Weight62kDa
  1. What is the species homology for "PRKAA1 Antibody - N-terminal region (ARP53846_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human, Rat, Rabbit".

  2. How long will it take to receive "PRKAA1 Antibody - N-terminal region (ARP53846_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "PRKAA1 Antibody - N-terminal region (ARP53846_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact

  4. What are other names for "PRKAA1 Antibody - N-terminal region (ARP53846_P050)"?

    This target may also be called "AMPK, AMPKa1, AMPK alpha 1" in publications.

  5. What is the shipping cost for "PRKAA1 Antibody - N-terminal region (ARP53846_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "PRKAA1 Antibody - N-terminal region (ARP53846_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "PRKAA1 Antibody - N-terminal region (ARP53846_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "62kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "PRKAA1 Antibody - N-terminal region (ARP53846_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "PRKAA1"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "PRKAA1"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "PRKAA1"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "PRKAA1"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "PRKAA1"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "PRKAA1"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:PRKAA1 Antibody - N-terminal region (ARP53846_P050)
Your Rating
We found other products you might like!