Catalog No: ARP53651_P050
Price: $0.00
SKU
ARP53651_P050
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.
Datasheets/ManualsPrintable datasheet for anti-Prkaa1 (ARP53651_P050) antibody
Product Info
Tested Species ReactivityHuman, Mouse, Rat
Predicted Species ReactivityHuman, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Sheep, Yeast, Zebrafish
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Sheep: 79%; Yeast: 77%; Zebrafish: 93%
Peptide SequenceSynthetic peptide located within the following region: STPSDIFMVMEYVSGGELFDYICKNGRLDEKESRRLFQQILSGVDYCHRH
Concentration0.5 mg/ml
Blocking PeptideFor anti-Prkaa1 (ARP53651_P050) antibody is Catalog # AAP53651
Subunitalpha-1
Gene SymbolPrkaa1
Gene Full NameProtein kinase, AMP-activated, alpha 1 catalytic subunit
Alias SymbolsAMPK, AI194361, AI450832, AL024255, AMPKalpha1, C130083N04Rik
NCBI Gene Id105787
Protein Name5'-AMP-activated protein kinase catalytic subunit alpha-1
Description of TargetPrkaa1 is a catalytic subunit of AMP-activated protein kinase (AMPK), an energy sensor protein kinase that plays a key role in regulating cellular energy metabolism.
Uniprot IDQ5EG47
Protein Accession #NP_001013385
Nucleotide Accession #NM_001013367
Protein Size (# AA)548
Molecular Weight60kDa
Protein InteractionsAscl4; Prkag1; Prkab1; Cidea; Eed; Mark4; NRBF2; TRIP6; Ubc;
  1. What is the species homology for "Prkaa1 Antibody - N-terminal region (ARP53651_P050)"?

    The tested species reactivity for this item is "Human, Mouse, Rat". This antibody is predicted to have homology to "Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Sheep, Yeast, Zebrafish".

  2. How long will it take to receive "Prkaa1 Antibody - N-terminal region (ARP53651_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "Prkaa1 Antibody - N-terminal region (ARP53651_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "Prkaa1 Antibody - N-terminal region (ARP53651_P050)"?

    This target may also be called "AMPK, AI194361, AI450832, AL024255, AMPKalpha1, C130083N04Rik" in publications.

  5. What is the shipping cost for "Prkaa1 Antibody - N-terminal region (ARP53651_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "Prkaa1 Antibody - N-terminal region (ARP53651_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "Prkaa1 Antibody - N-terminal region (ARP53651_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "60kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "Prkaa1 Antibody - N-terminal region (ARP53651_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "PRKAA1"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "PRKAA1"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "PRKAA1"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "PRKAA1"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "PRKAA1"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "PRKAA1"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:Prkaa1 Antibody - N-terminal region (ARP53651_P050)
Your Rating
We found other products you might like!