PREP Antibody - middle region : FITC (ARP56414_P050-FITC)

Catalog No: ARP56414_P050-FITC

Size:100ul

Product Info

• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.
• Clonality: Polyclonal
• Host: Rabbit
• Conjugation: FITC: Fluorescein Isothiocyanate
• Application: WB
• Reconstitution and Storage: All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human PREP
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 93%
• Peptide Sequence: Synthetic peptide located within the following region: LHSLKFIATLQYIVGRSRKQSNPLLIHVDTKAGHGAGKPTAKVIEEVSDM
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-PREP (ARP56414_P050-FITC) antibody is Catalog # AAP56414 (Previous Catalog # AAPP38723)
• Sample Type Confirmation:

  PREP is strongly supported by BioGPS gene expression data to be expressed in HT1080

Target Info

• Reference: Myohanen,T.T., (2007) Neurochem. Res. 32 (8), 1365-1374
• Gene Symbol: PREP
• Gene Full Name: Prolyl endopeptidase
• Alias Symbols: PE, PEP
• NCBI Gene Id: 5550
• Protein Name: Prolyl endopeptidase
• Description of Target: PREP is a cytosolic prolyl endopeptidase that cleaves peptide bonds on the C-terminal side of prolyl residues within peptides that are up to approximately 30 amino acids long. Prolyl endopeptidases have been reported to be involved in the maturation and d
• Uniprot ID: P48147
• Protein Accession #: NP_002717
• Nucleotide Accession #: NM_002726
• Protein Size (# AA): 710
• Molecular Weight: 81kDa
• Protein Interactions: SUMO1; BRCA1; TARS; UBD; SIRT7; UBC; OXT; NTS; TAC1; KNG1; AGT;