PRELID3B Antibody - N-terminal region (ARP56814_P050)

Catalog No: ARP56814_P050

Click here to learn more about Aviva's By-Request Conjugation Service.

WB Suggested Anti-SLMO2 Antibody Titration: 0.2-1 ug/ml
Positive Control: Human Stomach

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human SLMO2
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
• Peptide Sequence: Synthetic peptide located within the following region: GVDVLDRHIDPSGKLHSHRLLSTEWGLPSIVKSLIGAARTKTYVQEHSVV
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-PRELID3B (ARP56814_P050) antibody is Catalog # AAP56814 (Previous Catalog # AAPP39723)

Target Info

• Gene Symbol: PRELID3B
• Gene Full Name: PRELI domain containing 3B
• Alias Symbols: SLMO2, C20orf45, dJ543J19.5
• NCBI Gene Id: 51012
• Protein Name: PRELI domain containing protein 3B
• Uniprot ID: A5GFX0
• Protein Accession #: NP_057129
• Nucleotide Accession #: NM_016045
• Protein Size (# AA): 194
• Molecular Weight: 21kDa
• Protein Interactions: UBC; ELAVL1;