Catalog No: ARP54832_P050
Price: $0.00
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.
Datasheets/ManualsPrintable datasheet for anti-PRDX5 (ARP54832_P050) antibody
Product Info
ReferenceTrujillo,M., (2007) Arch. Biochem. Biophys. 467 (1), 95-106
Tested Species ReactivityHuman
Predicted Species ReactivityHuman, Mouse, Rat, Dog, Goat, Guinea Pig, Horse, Pig, Sheep
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of human PRDX5
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceDog: 86%; Goat: 79%; Guinea Pig: 79%; Horse: 93%; Human: 100%; Mouse: 93%; Pig: 93%; Rat: 93%; Sheep: 79%
Peptide SequenceSynthetic peptide located within the following region: TDLLLDDSLVSIFGNRRLKRFSMVVQDGIVKALNVEPDGTGLTCSLAPNI
Concentration0.5 mg/ml
Blocking PeptideFor anti-PRDX5 (ARP54832_P050) antibody is Catalog # AAP54832 (Previous Catalog # AAPP31636)
Gene SymbolPRDX5
Gene Full NamePeroxiredoxin 5
Alias SymbolsPLP, ACR1, B166, PRXV, PMP20, PRDX6, prx-V, SBBI10, AOEB166, HEL-S-55
NCBI Gene Id25824
Protein NamePeroxiredoxin 5 EMBL AAI71733.1
Description of TargetPRDX5 is a member of the peroxiredoxin family of antioxidant enzymes, which reduce hydrogen peroxide and alkyl hydroperoxides. The encoded protein may play an antioxidant protective role in different tissues under normal conditions and during inflammatory processes. This protein interacts with peroxisome receptor 1. The crystal structure of this protein in its reduced form has been resolved to 1.5 angstrom resolution. This gene uses alternate in-frame translation initiation sites to generate mitochondrial or peroxisomal/cytoplasmic forms.This gene encodes a member of the peroxiredoxin family of antioxidant enzymes, which reduce hydrogen peroxide and alkyl hydroperoxides. The encoded protein may play an antioxidant protective role in different tissues under normal conditions and during inflammatory processes. This protein interacts with peroxisome receptor 1. The crystal structure of this protein in its reduced form has been resolved to 1.5 angstrom resolution. This gene uses alternate in-frame translation initiation sites to generate mitochondrial or peroxisomal/cytoplasmic forms. Three transcript variants encoding distinct isoforms have been identified for this gene.
Uniprot IDB7ZVW3
Protein Accession #NP_857635
Nucleotide Accession #NM_181652
Protein Size (# AA)125
Molecular Weight14kDa
  1. What is the species homology for "PRDX5 Antibody - middle region (ARP54832_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human, Mouse, Rat, Dog, Goat, Guinea Pig, Horse, Pig, Sheep".

  2. How long will it take to receive "PRDX5 Antibody - middle region (ARP54832_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "PRDX5 Antibody - middle region (ARP54832_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact

  4. What are other names for "PRDX5 Antibody - middle region (ARP54832_P050)"?

    This target may also be called "PLP, ACR1, B166, PRXV, PMP20, PRDX6, prx-V, SBBI10, AOEB166, HEL-S-55" in publications.

  5. What is the shipping cost for "PRDX5 Antibody - middle region (ARP54832_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "PRDX5 Antibody - middle region (ARP54832_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "PRDX5 Antibody - middle region (ARP54832_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "14kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "PRDX5 Antibody - middle region (ARP54832_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "PRDX5"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "PRDX5"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "PRDX5"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "PRDX5"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "PRDX5"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "PRDX5"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:PRDX5 Antibody - middle region (ARP54832_P050)
Your Rating
We found other products you might like!