Aviva Systems Biology office will be closed for Christmas and New Year Holiday - December 24-25, 2018 and January 1, 2019.
Please go here for more info.

Now Offering Over 102,157 Antibodies & 44,722 Antigens!

PRDX3 antibody - N-terminal region (ARP52341_P050)

100 ul
$319.00
In Stock

Conjugation Options

ARP52341_P050-FITC Conjugated

ARP52341_P050-HRP Conjugated

ARP52341_P050-Biotin Conjugated

Gene Symbol:
PRDX3
NCBI Gene Id:
10935
Official Gene Full Name:
Peroxiredoxin 3
Protein Name:
Thioredoxin-dependent peroxide reductase, mitochondrial
Swissprot Id:
P30048
Protein Accession #:
NP_054817
Nucleotide Accession #:
NM_014098
Alias Symbols:
AOP-1, AOP1, MER5, MGC104387, MGC24293, PRO1748, SP-22, HBC189, prx-III
Replacement Item:
This antibody may replace item sc-130336 from Santa Cruz Biotechnology.
Description of Target:
PRDX3 is a protein with antioxidant function and is localized in the mitochondrion. Expression of this gene product in E. coli deficient in the C22-subunit gene rescued resistance of the bacteria to alkylhydroperoxide. The human and mouse genes are highly conserved, and they map to the regions syntenic between mouse and human chromosomes. Sequence comparisons with recently cloned mammalian homologues suggest that these genes consist of a family that is responsible for regulation of cellular proliferation, differentiation, and antioxidant functions. This gene encodes a protein with antioxidant function and is localized in the mitochondrion. This gene shows significant nucleotide sequence similarity to the gene coding for the C22 subunit of Salmonella typhimurium alkylhydroperoxide reductase. Expression of this gene product in E. coli deficient in the C22-subunit gene rescued resistance of the bacteria to alkylhydroperoxide. The human and mouse genes are highly conserved, and they map to the regions syntenic between mouse and human chromosomes. Sequence comparisons with recently cloned mammalian homologues suggest that these genes consist of a family that is responsible for regulation of cellular proliferation, differentiation, and antioxidant functions. Two transcript variants encoding two different isoforms have been found for this gene.
Protein Size (# AA):
238
Molecular Weight:
26kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity Purified
Application:
IHC, WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express PRDX3.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express PRDX3.
Immunogen:
The immunogen is a synthetic peptide directed towards the N terminal region of human PRDX3
Species Reactivity:
Human
Predicted Homology Based on Immunogen Sequence:
Human: 100%
Complete computational species homology data:
Anti-PRDX3 (ARP52341_P050)
Peptide Sequence:
Synthetic peptide located within the following region: AIPWGISATAALRPAACGRTSLTNLLCSGSSQAPYFKGTAVVNGEFKDLS
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
GORASP2; SUMO1; NEDD8; MDM2; ARMCX3; NUSAP1; LNPEP; HNRNPD; NEK6; CDK2; UBC; TNFRSF1A; ITGA4; FN1; RPS6KC1; PRDX3; PRDX4; VCAM1; RNASET2; PSME1; PFKL; SPEN; UBQLN4; DCUN1D1; COPS5; CUL1; CUL2; CUL3; CUL4B; CUL5; SUMO4; MAPK3; NLRX1; HDAC5; UCHL5; H2AFX; T
Blocking Peptide:
For anti-PRDX3 (ARP52341_P050) antibody is Catalog # AAP52341 (Previous Catalog # AAPS30806)
Datasheets/Manuals:
Printable datasheet for anti-PRDX3 (ARP52341_P050) antibody
Sample Type Confirmation:

PRDX3 is supported by BioGPS gene expression data to be expressed in Jurkat

Target Reference:
Chiribau,C.B., (2008) J. Biol. Chem. 283 (13), 8211-8217

Tell us what you think about this item!

Write A Review
    Please, wait...