SAVE NOW with 10% off all Recombinant Antibodies Shop Now

Catalog No: ARP89809_P050
Price: $0.00
Availability: Domestic: within 24 hours delivery | International: 3-5 days
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.
Datasheets/ManualsPrintable datasheet for anti-PRDX2 (ARP89809_P050) antibody
Product Info
Predicted Species ReactivityMouse
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the C terminal region of mouse PRDX2
PurificationAffinity purified
Peptide SequenceSynthetic peptide located within the following region: GRSVDEALRLVQAFQYTDEHGEVCPAGWKPGSDTIKPNVDDSKEYFSKHN
Concentration0.5 mg/ml
Blocking PeptideFor anti-PRDX2 (ARP89809_P050) antibody is Catalog # AAP89809
Gene SymbolPRDX2
Gene Full Nameperoxiredoxin 2
Alias SymbolsP, T, TP, TR, PRP, TPx, TSA, TDX1, Tdpx, NkefB, PrxII, TPx-B, Tdpx1, Torin, Band-8, AL022839
NCBI Gene Id21672
Protein Nameperoxiredoxin-2
Description of TargetThiol-specific peroxidase that catalyzes the reduction of hydrogen peroxide and organic hydroperoxides to water and alcohols, respectively. Plays a role in cell protection against oxidative stress by detoxifying peroxides and as sensor of hydrogen peroxide-mediated signaling events. Might participate in the signaling cascades of growth factors and tumor necrosis factor-alpha by regulating the intracellular concentrations of H2O2.
Uniprot IDQ61171
Protein Accession #NP_001304314.1
Nucleotide Accession #NM_001317385.1
Protein Size (# AA)198
Molecular Weight22 kDa
  1. What is the species homology for "PRDX2 Antibody - C-terminal region (ARP89809_P050)"?

    The tested species reactivity for this item is "". This antibody is predicted to have homology to "Mouse".

  2. How long will it take to receive "PRDX2 Antibody - C-terminal region (ARP89809_P050)"?

    This item is available "Domestic: within 24 hours delivery | International: 3-5 days".

  3. What buffer format is "PRDX2 Antibody - C-terminal region (ARP89809_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact

  4. What are other names for "PRDX2 Antibody - C-terminal region (ARP89809_P050)"?

    This target may also be called "P, T, TP, TR, PRP, TPx, TSA, TDX1, Tdpx, NkefB, PrxII, TPx-B, Tdpx1, Torin, Band-8, AL022839" in publications.

  5. What is the shipping cost for "PRDX2 Antibody - C-terminal region (ARP89809_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "PRDX2 Antibody - C-terminal region (ARP89809_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "PRDX2 Antibody - C-terminal region (ARP89809_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "22 kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "PRDX2 Antibody - C-terminal region (ARP89809_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "PRDX2"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "PRDX2"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "PRDX2"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "PRDX2"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "PRDX2"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "PRDX2"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:PRDX2 Antibody - C-terminal region (ARP89809_P050)
Your Rating