PRDX1 Recombinant Protein (Chinese hamster) (OPCA04275)

Catalog No: OPCA04275

Product Info

• Predicted Species Reactivity: Chinese Hamster|Cricetulus griseus
• Product Format: Liquid or Lyophilized powder
• Additional Information: Species Specificity Detail: Cricetulus griseus (Chinese hamster) (Cricetulus barabensis griseus)
• Reconstitution and Storage: -20°C or -80°C
• Formulation: Tris-base, 50% glycerol
• Purity: Greater than 90% as determined by SDS-PAGE.
• Peptide Sequence: SSGNAKIGYPAPNFKATAVMPDGQFRDICLSEYRGKYVVFFFYPLDFTFVCPTEIIAFSDRAEEFKKLNCQVIGASVDSHFCHLAWINTPKKQGGLGPMNIPLVSDPKRTIAQDYGVLKADEGISFRGLFIIDDKGILRQITINDLPVGRSVDEILRLVQAFQFTDKHGEVCPAGWKPGSDTIKPDVQKSKEYFSKQK
• Protein Sequence: SSGNAKIGYPAPNFKATAVMPDGQFRDICLSEYRGKYVVFFFYPLDFTFVCPTEIIAFSDRAEEFKKLNCQVIGASVDSHFCHLAWINTPKKQGGLGPMNIPLVSDPKRTIAQDYGVLKADEGISFRGLFIIDDKGILRQITINDLPVGRSVDEILRLVQAFQFTDKHGEVCPAGWKPGSDTIKPDVQKSKEYFSKQK
• Storage Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Source: E.coli
• Protein Range: 2-199 aa
• Tag: N-terminal 6xHis-tagged

Target Info

• Reference: Identification of galectin I and thioredoxin peroxidase II as two arsenic-binding proteins in Chinese hamster ovary cells.Chang K.N., Lee T.C., Tam M.F., Chen Y.C., Lee L.W., Lee S.Y., Lin P.J., Huang R.N.Biochem. J. 371:495-503(2003).
• Gene Symbol: Prdx1
• Gene Full Name: peroxiredoxin 1
• Alias Symbols: peroxiredoxin-1;TDPX2;Thioredoxin peroxidase 2;thioredoxin peroxidase II;thioredoxin-dependent peroxiredoxin 1;TPX-2.
• NCBI Gene Id: 100689332
• Protein Name: Peroxiredoxin-1
• Description of Target: Thiol-specific peroxidase that catalyzes the reduction of hydrogen peroxide and organic hydroperoxides to water and alcohols, respectively. Plays a role in cell protection against oxidative stress by detoxifying peroxides and as sensor of hydrogen peroxide-mediated signaling events. Might participate in the signaling cascades of growth factors and tumor necrosis factor-alpha by regulating the intracellular concentrations of H(2)O(2) (By similarity). Reduces an intramolecular disulfide bond in GDPD5 that gates the ability to GDPD5 to drive postmitotic motor neuron differentiation (By similarity).
• Uniprot ID: Q9JKY1
• Protein Accession #: NP_001233694
• Nucleotide Accession #: NM_001246765
• Protein Size (# AA): Recombinant
• Molecular Weight: 26.1 kDa