PRDM16 Antibody - middle region (ARP80869_P050)

Catalog No: ARP80869_P050

Host: Rabbit
Target Name: PRDM16
Sample Tissue: Human K562 Whole Cell lysates
Antibody Dilution: 1ug/ml

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human PRDM16
• Purification: Affinity purified
• Peptide Sequence: Synthetic peptide located within the following region: SAPASGEEQPLDLSIGSRARASQNGGGREPRKNHVYGERKLGAGEGLPQV
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-PRDM16 (ARP80869_P050) antibody is Catalog # AAP80869

Target Info

• Gene Symbol: PRDM16
• Gene Full Name: PR domain 16
• Alias Symbols: MEL1, KMT8F, LVNC8, PFM13, CMD1LL
• NCBI Gene Id: 63976
• Protein Name: PR domain zinc finger protein 16
• Description of Target: The reciprocal translocation t(1;3)(p36;q21) occurs in a subset of myelodysplastic syndrome (MDS) and acute myeloid leukemia (AML). This gene is located near the 1p36.3 breakpoint and has been shown to be specifically expressed in the t(1:3)(p36,q21)-positive MDS/AML. The protein encoded by this gene is a zinc finger transcription factor and contains an N-terminal PR domain. The translocation results in the overexpression of a truncated version of this protein that lacks the PR domain, which may play an important role in the pathogenesis of MDS and AML. Alternatively spliced transcript variants encoding distinct isoforms have been reported.
• Uniprot ID: Q9HAZ2-4
• Protein Accession #: NP_071397.3
• Nucleotide Accession #: NM_022114.3
• Protein Size (# AA): 1092
• Molecular Weight: 120 kDa