SAVE NOW with 10% off all Recombinant Antibodies Shop Now

Catalog No: ARP33260_P050
Price: $0.00
SKU
ARP33260_P050
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.
Datasheets/ManualsPrintable datasheet for anti-PRDM16 (ARP33260_P050) antibody
Product Info
Tested Species ReactivityHuman
Predicted Species ReactivityHuman, Rat, Cow, Guinea Pig, Horse, Pig
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of human PRDM16
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 92%; Dog: 77%; Guinea Pig: 86%; Horse: 85%; Human: 100%; Mouse: 79%; Pig: 92%; Rat: 86%
Peptide SequenceSynthetic peptide located within the following region: LNHTQDAKLPSPLGNPALPLVSAVSNSSQGTTAAAGPEEKFESRLEDSCV
Concentration0.5 mg/ml
Blocking PeptideFor anti-PRDM16 (ARP33260_P050) antibody is Catalog # AAP33260 (Previous Catalog # AAPP04302)
Gene SymbolPRDM16
Gene Full NamePR domain containing 16
Alias SymbolsMEL1, KMT8F, LVNC8, PFM13, CMD1LL
NCBI Gene Id63976
Protein NamePR domain zinc finger protein 16
Description of TargetThe reciprocal translocation t(1;3)(p36;q21) occurs in a subset of myelodysplastic syndrome (MDS) and acute myeloid leukemia (AML). This gene is located near the 1p36.3 breakpoint and has been shown to be specifically expressed in the t(1:3)(p36,q21)-positive MDS/AML. The protein encoded by this gene is a zinc finger transcription factor and contains an N-terminal PR domain. The translocation results in the overexpression of a truncated version of this protein that lacks the PR domain, which may play an important role in the pathogenesis of MDS and AML. Alternatively spliced transcript variants encoding distinct isoforms have been reported.
Uniprot IDQ9HAZ2
Protein Accession #NP_071397
Nucleotide Accession #NM_022114
Protein Size (# AA)1275
Molecular Weight140kDa
Protein InteractionsTFAP4; UBC; HDAC2; Ctbp2; SUMO1; SKI; SMAD3; SMAD2; INADL;
  1. What is the species homology for "PRDM16 Antibody - middle region (ARP33260_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human, Rat, Cow, Guinea Pig, Horse, Pig".

  2. How long will it take to receive "PRDM16 Antibody - middle region (ARP33260_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "PRDM16 Antibody - middle region (ARP33260_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "PRDM16 Antibody - middle region (ARP33260_P050)"?

    This target may also be called "MEL1, KMT8F, LVNC8, PFM13, CMD1LL" in publications.

  5. What is the shipping cost for "PRDM16 Antibody - middle region (ARP33260_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "PRDM16 Antibody - middle region (ARP33260_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "PRDM16 Antibody - middle region (ARP33260_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "140kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "PRDM16 Antibody - middle region (ARP33260_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "PRDM16"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "PRDM16"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "PRDM16"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "PRDM16"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "PRDM16"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "PRDM16"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:PRDM16 Antibody - middle region (ARP33260_P050)
Your Rating
We found other products you might like!