PRDM1 Antibody - middle region (P100596_P050)

Catalog No: P100596_P050

25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 3 ug/mL of the antibody was used in this experiment. The peptide sequence is present in a 77 kDa isoform. The protein may be modified by glycosylation.

Immunohistochemistry with Spleen cell lysate tissue at an antibody concentration of 5.0ug/ml using anti-PRDM1 antibody (P100596_P050)

Anti-BLIMP-1 antibody IHC staining of human pancreas. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval. Antibody concentration 5 ug/ml.

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: IHC, WB
• Additional Information: IHC Information: Pancreas
  IHC Information: Spleen
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human PRDM1
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 100%; Guinea Pig: 84%; Horse: 100%; Human: 100%; Mouse: 92%; Pig: 100%; Rabbit: 92%; Rat: 92%
• Peptide Sequence: Synthetic peptide located within the following region: VEDDISVISVVEKEILAVVRKEKEETGLKVSLQRNMGNGLLSSGCSLYES
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-PRDM1 (P100596_P050) antibody is Catalog # AAP30899 (Previous Catalog # AAPP01623)
• Reference: Diehl,S.A., (2008) J. Immunol. 180 (7), 4805-4815
• Publications:

  VEGF-Mediated Induction of PRD1-BF1/Blimp1 Expression Sensitizes Tumor Vasculature to Oncolytic Virus Infection. Cancer Cell. 28, 210-24 (2015). 26212250

• Description:
  View product citations for PRDM1 Antibody - middle region (P100596_P050)on CiteAb

Target Info

• Gene Symbol: PRDM1
• Gene Full Name: PR domain containing 1, with ZNF domain
• Alias Symbols: BLIMP1, PRDI-BF1
• NCBI Gene Id: 639
• Protein Name: PR domain zinc finger protein 1
• Description of Target: PRDM1 is a protein that acts as a repressor of beta-interferon gene expression. The protein binds specifically to the PRDI (positive regulatory domain I element) of the beta-IFN gene promoter. Transcription of this gene increases upon virus induction. Two alternatively spliced transcript variants that encode different isoforms have been reported. This gene encodes a protein that acts as a repressor of beta-interferon gene expression. The protein binds specifically to the PRDI (positive regulatory domain I element) of the beta-IFN gene promoter. Transcription of this gene increases upon virus induction. Two alternatively spliced transcript variants that encode different isoforms have been reported.
• Uniprot ID: Q86WM7
• Protein Accession #: NP_878911
• Nucleotide Accession #: NM_182907
• Protein Size (# AA): 825
• Molecular Weight: 92 kDa
• Protein Interactions: PRMT5; SENP1; EHMT2; PIAS1; SUMO1; IRF2; IRF1; HDAC2; HDAC1; HIST1H1A; MS4A1; HSP90AA1; ATXN1; ELAVL1; KDM1A; IRF4; TLE2; TLE1; AES; PRMT7; HIST2H3A;