Aviva Systems Biology will be closed in observance of Good Friday 3/29/2024. If you are in need of any assistance please email info@avivasysbio.com

Catalog No: ARP47857_P050-HRP
Size:100ul
Price: $434.00
SKU
ARP47857_P050-HRP
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.

prd Antibody - middle region : HRP (ARP47857_P050-HRP)

Click here to learn more about Aviva's By-Request Conjugation Service.
Datasheets/ManualsPrintable datasheet for anti-prd (ARP47857_P050-HRP) antibody
Product Info
Product FormatLiquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
ClonalityPolyclonal
HostRabbit
ConjugationHRP: Horseradish Peroxidase
ApplicationWB
Reconstitution and StorageAll conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
ImmunogenThe immunogen is a synthetic peptide corresponding to a region of Fruit fly
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceFruit fly: 100%
Peptide SequenceSynthetic peptide located within the following region: MTVTAFAAAMHRPFFNGYSTMQDMNSGQGRVNQLGGVFINGRPLPNNIRL
Concentration0.5 mg/ml
Blocking PeptideFor anti-prd (ARP47857_P050-HRP) antibody is Catalog # AAP47857 (Previous Catalog # AAPP27301)
Gene Symbolprd
Gene Full NamePaired
Alias SymbolsCG6716, Dmel\CG6716, pr, Prd, PRD
NCBI Gene Id34629
Protein NameSegmentation protein paired
Description of TargetPrd is a pair-rule protein expressed in a segmentally repeating pattern to define the polarity of embryonic segments.
Uniprot IDP06601
Protein Accession #NP_723721
Nucleotide Accession #NM_164990
Protein Size (# AA)613
Molecular Weight65kDa
Protein Interactionsci; Rassf; Ras85D; Mlf; Damm; Mer; CG42676; gsb; CycE; LIMK1; dm;
  1. What is the species homology for "prd Antibody - middle region : HRP (ARP47857_P050-HRP)"?

    The tested species reactivity for this item is "". This antibody is predicted to have homology to "".

  2. How long will it take to receive "prd Antibody - middle region : HRP (ARP47857_P050-HRP)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "prd Antibody - middle region : HRP (ARP47857_P050-HRP)" provided in?

    This item is provided in "Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "prd Antibody - middle region : HRP (ARP47857_P050-HRP)"?

    This target may also be called "CG6716, Dmel\CG6716, pr, Prd, PRD" in publications.

  5. What is the shipping cost for "prd Antibody - middle region : HRP (ARP47857_P050-HRP)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "prd Antibody - middle region : HRP (ARP47857_P050-HRP)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "prd Antibody - middle region : HRP (ARP47857_P050-HRP)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "65kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "prd Antibody - middle region : HRP (ARP47857_P050-HRP)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "PRD"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "PRD"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "PRD"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "PRD"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "PRD"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "PRD"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:prd Antibody - middle region : HRP (ARP47857_P050-HRP)
Your Rating
We found other products you might like!