SAVE NOW with 10% off all Recombinant Antibodies Shop Now

Catalog No: ARP55982_P050
Price: $0.00
SKU
ARP55982_P050
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.
Datasheets/ManualsPrintable datasheet for anti-PRAME (ARP55982_P050) antibody
Product Info
Tested Species ReactivityHuman
Predicted Species ReactivityHuman, Mouse, Rat, Cow, Horse, Rabbit
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human PRAME
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 92%; Horse: 79%; Human: 100%; Mouse: 92%; Rabbit: 79%; Rat: 92%
Peptide SequenceSynthetic peptide located within the following region: AMVQAWPFTCLPLGVLMKGQHLHLETFKAVLDGLDVLLAQEVRPRRWKLQ
Concentration0.5 mg/ml
Blocking PeptideFor anti-PRAME (ARP55982_P050) antibody is Catalog # AAP55982 (Previous Catalog # AAPP37329)
ReferenceIkeda,H., (2007) Leuk. Res. 31 (11), 1521-1528
Publications

Subcellular localization of the mouse PRAMEL1 and PRAMEX1 reveals multifaceted roles in the nucleus and cytoplasm of germ cells during spermatogenesis. Cell Biosci. 11, 102 (2021). 34074333

Gene SymbolPRAME
Gene Full NamePreferentially expressed antigen in melanoma
Alias SymbolsMAPE, OIP4, CT130, OIP-4
NCBI Gene Id23532
Protein NameMelanoma antigen preferentially expressed in tumors
Description of TargetPRAME functions as a transcriptional repressor, inhibiting the signaling of retinoic acid through the retinoic acid receptors RARA, RARB and RARG. PRAME prevents retinoic acid-induced cell proliferation arrest, differentiation and apoptosis.This gene encodes an antigen that is predominantly expressed in human melanomas and that is recognized by cytolytic T lymphocytes. It is not expressed in normal tissues, except testis. This expression pattern is similar to that of other CT antigens, such as MAGE, BAGE and GAGE. However, unlike these other CT antigens, this gene is also expressed in acute leukemias. Five alternatively spliced transcript variants encoding the same protein have been observed for this gene.
Uniprot IDP78395
Protein Accession #NP_006106
Nucleotide Accession #NM_006115
Protein Size (# AA)509
Molecular Weight56kDa
Protein InteractionsPRAME; RBX1; CUL2; TCEB2; TCEB1; ZNF408; FBXL12; XRN2; HIST4H4; HIST2H2BE; HIST2H2AC; HIST3H3; UBC; RARA; TP53RK; OSGEP; TPRKB; KDM1A; BAG2; LAGE3; UBL4A; SNRPB; RPS13; RPL22; RPL10; RFC4; PSMC4; HNRNPM; HNRNPH1; HNRNPF; HNRNPC; NEDD8; STK19;
  1. What is the species homology for "PRAME Antibody - N-terminal region (ARP55982_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human, Mouse, Rat, Cow, Horse, Rabbit".

  2. How long will it take to receive "PRAME Antibody - N-terminal region (ARP55982_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "PRAME Antibody - N-terminal region (ARP55982_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "PRAME Antibody - N-terminal region (ARP55982_P050)"?

    This target may also be called "MAPE, OIP4, CT130, OIP-4" in publications.

  5. What is the shipping cost for "PRAME Antibody - N-terminal region (ARP55982_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "PRAME Antibody - N-terminal region (ARP55982_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "PRAME Antibody - N-terminal region (ARP55982_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "56kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "PRAME Antibody - N-terminal region (ARP55982_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "PRAME"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "PRAME"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "PRAME"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "PRAME"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "PRAME"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "PRAME"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:PRAME Antibody - N-terminal region (ARP55982_P050)
Your Rating
We found other products you might like!