Search Antibody, Protein, and ELISA Kit Solutions

PQBP1 Antibody - middle region (ARP31454_T100)

100 ul
In Stock
Request Bulk Order Quote

Conjugation Options

ARP31454_T100-FITC Conjugated

ARP31454_T100-HRP Conjugated

ARP31454_T100-Biotin Conjugated

Gene Symbol:
Official Gene Full Name:
polyglutamine binding protein 1
NCBI Gene Id:
Protein Name:
polyglutamine-binding protein 1
Swissprot Id:
Alias Symbols:
Replacement Item:
This antibody may replace item sc-26052 from Santa Cruz Biotechnology.
Description of Target:
This gene encodes a nuclear polyglutamine-binding protein that is involved with transcription activation. The encoded protein contains a WW domain. Mutations in this gene have been found in patients with Renpenning syndrome 1 and other syndromes with X-linked cognitive disability. Multiple alternatively spliced transcript variants that encode different protein isoforms have been described for this gene.
Protein Size (# AA):
Molecular Weight:
Protein A purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express PQBP1.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express PQBP1.
The immunogen is a synthetic peptide directed towards the middle region of human PQBP1
Predicted Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat
Tested Species Reactivity:
Predicted Homology Based on Immunogen Sequence:
Cow: 93%; Dog: 93%; Guinea Pig: 86%; Horse: 93%; Human: 100%; Mouse: 86%; Pig: 93%; Rabbit: 86%; Rat: 93%
Complete computational species homology data:
Anti-PQBP1 (ARP31454_T100)
Peptide Sequence:
Synthetic peptide located within the following region: PSCGLPYYWNADREEGKERRHHRREELAPYPKSKKAVSRKDEELDPMDPS
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
Blocking Peptide:
For anti-PQBP1 (ARP31454_T100) antibody is Catalog # AAP31454 (Previous Catalog # AAPP02216)
Printable datasheet for anti-PQBP1 (ARP31454_T100) antibody
Target Reference:
Waragai,M. et al., (1999) Hum Mol Genet. 8(6):977-87

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...