Size:100 ul
$229.00
In Stock
SKU
ARP31454_T100
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP31454_T100-FITC Conjugated

ARP31454_T100-HRP Conjugated

ARP31454_T100-Biotin Conjugated

PQBP1 Antibody - middle region (ARP31454_T100)

Catalog#: ARP31454_T100
Domestic: within 1-2 days delivery | International: 1-2 days
More Information
Tested Species Reactivity Human
Predicted Species Reactivity Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality Polyclonal
Host Rabbit
Application IHC, WB
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item This antibody may replace item sc-26052 from Santa Cruz Biotechnology.
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human PQBP1
Purification Protein A purified
Predicted Homology Based on Immunogen Sequence Cow: 93%; Dog: 93%; Guinea Pig: 86%; Horse: 93%; Human: 100%; Mouse: 86%; Pig: 93%; Rabbit: 86%; Rat: 93%
Complete computational species homology data Anti-PQBP1 (ARP31454_T100)
Peptide Sequence Synthetic peptide located within the following region: PSCGLPYYWNADREEGKERRHHRREELAPYPKSKKAVSRKDEELDPMDPS
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide For anti-PQBP1 (ARP31454_T100) antibody is Catalog # AAP31454 (Previous Catalog # AAPP02216)
Datasheets/Manuals Printable datasheet for anti-PQBP1 (ARP31454_T100) antibody
Target Reference Waragai,M. et al., (1999) Hum Mol Genet. 8(6):977-87
Gene Symbol PQBP1
Official Gene Full Name polyglutamine binding protein 1
Alias Symbols SHS, MRX2, MRX55, MRXS3, MRXS8, NPW38, RENS1
NCBI Gene Id 10084
Protein Name polyglutamine-binding protein 1
Description of Target This gene encodes a nuclear polyglutamine-binding protein that is involved with transcription activation. The encoded protein contains a WW domain. Mutations in this gene have been found in patients with Renpenning syndrome 1 and other syndromes with X-linked cognitive disability. Multiple alternatively spliced transcript variants that encode different protein isoforms have been described for this gene.
Swissprot Id O60828-5
Protein Size (# AA) 265
Molecular Weight 30kDa
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express PQBP1.
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express PQBP1.
Protein Interactions MAPRE1; GOLGA2; LZTS2; UBC; APBB1; WDR77; AQR; HNRNPH2; MRPL53; SLIRP; SRPRB; SUGP1; MRPS28; RPS6KA6; HRSP12; SCO2; ZC3H11A; UBL4A; VDAC3; RRBP1; RPS28; RBMS1; NDUFA7; IDH3G; APP; WBP11; RCVRN; LNX1; SF3A2; SFTPC; TXNL4A; TLX3; LRIF1; MED31; POLR2A; C14or
  1. What is the species homology for "PQBP1 Antibody - middle region (ARP31454_T100)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat".

  2. How long will it take to receive "PQBP1 Antibody - middle region (ARP31454_T100)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "PQBP1 Antibody - middle region (ARP31454_T100)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "PQBP1 Antibody - middle region (ARP31454_T100)"?

    This target may also be called "SHS, MRX2, MRX55, MRXS3, MRXS8, NPW38, RENS1" in publications.

  5. What is the shipping cost for "PQBP1 Antibody - middle region (ARP31454_T100)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "PQBP1 Antibody - middle region (ARP31454_T100)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "PQBP1 Antibody - middle region (ARP31454_T100)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "30kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "PQBP1 Antibody - middle region (ARP31454_T100)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data tab on the product page.

  10. What are positive controls for "PQBP1"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "PQBP1"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "PQBP1"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "PQBP1"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "PQBP1"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "PQBP1"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:PQBP1 Antibody - middle region (ARP31454_T100)
Your Rating
We found other products you might like!