Search Antibody, Protein, and ELISA Kit Solutions

PPP3R1 Antibody - N-terminal region (ARP56124_P050)

100 ul

Regular Price: $289.00

Special Price: $229.00

In Stock
Request Bulk Order Quote

Conjugation Options

ARP56124_P050-FITC Conjugated

ARP56124_P050-HRP Conjugated

ARP56124_P050-Biotin Conjugated

Tested Species Reactivity:
Predicted Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item:
This antibody may replace item sc-130393 from Santa Cruz Biotechnology.
The immunogen is a synthetic peptide directed towards the N terminal region of human PPP3R1
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100%
Complete computational species homology data:
Anti-PPP3R1 (ARP56124_P050)
Peptide Sequence:
Synthetic peptide located within the following region: MGNEASYPLEMCSHFDADEIKRLGKRFKKLDLDNSGSLSVEEFMSLPELQ
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide:
For anti-PPP3R1 (ARP56124_P050) antibody is Catalog # AAP56124 (Previous Catalog # AAPP37745)
Printable datasheet for anti-PPP3R1 (ARP56124_P050) antibody
B type 1
Target Reference:
Wang,Y.L., (2008) Cancer Sci. 99 (6), 1100-1108
Gene Symbol:
Official Gene Full Name:
Protein phosphatase 3, regulatory subunit B, alpha
Alias Symbols:
NCBI Gene Id:
Protein Name:
Calcineurin subunit B type 1
Description of Target:
PPP3R1 is the regulatory subunit of calcineurin, a calcium-dependent, calmodulin stimulated protein phosphatase. PPP3R1 confers calcium sensitivity.
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Protein Size (# AA):
Molecular Weight:
Affinity Purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express PPP3R1.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express PPP3R1.
Protein Interactions:

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...