- Toll Free: 888-880-0001
- Phone: 858-552-6979
- Email: info@avivasysbio.com
- $55: Antibody & Protein in US
- $55 + $25/Kit in US
- Contact us for international orders.
Datasheets/Manuals | Printable datasheet for PPP3CC Antibody (OAAL00255) |
---|
Predicted Species Reactivity | Human, Mouse |
---|---|
Product Format | Liquid |
Clonality | Monoclonal |
Clone | 4D1 |
Isotype | IgG1 Kappa |
Host | Mouse |
Application | Enzyme-linked immunosorbent assay|Western blot |
Reconstitution and Storage | Store at -20C or lower. Aliquot to avoid repeated freezing and thawing. |
Immunogen | PPP3CC (NP_005596.2, 1 a.a. ~ 81 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Peptide Sequence | MSGRRFHLSTTDRVIKAVPFPPTQRLTFKEVFENGKPKVDVLKNHLVKEGRLEEEVALKIINDGAAILRQEKTMIEVDAPI |
Formulation | In 1x PBS, pH 7.4 |
Gene Symbol | PPP3CC |
---|---|
Gene Full Name | protein phosphatase 3 catalytic subunit gamma |
Alias Symbols | calcineurin, testis-specific catalytic subunit;CALNA3;CAM-PRP catalytic subunit;CNA3;PP2Bgamma;protein phosphatase 3, catalytic subunit, gamma isozyme;serine/threonine-protein phosphatase 2B catalytic subunit gamma isoform. |
NCBI Gene Id | 5533 |
Protein Name | Homo sapiens protein phosphatase 3 catalytic subunit gamma (PPP3CC), transcript variant 2, mRNA|serine/threonine-protein phosphatase 2B catalytic subunit gamma isoform isoform 2 [Homo sapiens] |
Description of Target | Calmodulin-dependent protein phosphatase, calcineurin, is involved in a wide range of biologic activities, acting as a Ca(2+)-dependent modifier of phosphorylation status. In testis, the motility of the sperm is thought to be controlled by cAMP-dependent phosphorylation and a unique form of calcineurin appears to be associated with the flagellum. The calcineurin holoenzyme is composed of catalytic and regulatory subunits of 60 and 18 kD, respectively. At least 3 genes, calcineurin A-alpha (CALNA1; MIM 114105), calcineurin A-beta (CALNA2; MIM 114106), and calcineurin A-gamma (CALNA3), have been cloned for the catalytic subunit. These genes have been identified in humans, mice, and rats, and are highly conserved between species (90 to 95% amino acid identity).[supplied by OMIM |
Protein Accession # | https://www.ncbi.nlm.nih.gov/protein/NP_005596.2 |
Nucleotide Accession # | https://www.ncbi.nlm.nih.gov/nuccore/NM_005605 |
- Protocol:
- Reconstitution & Storage Instructions
- Western Blotting/Immunoblotting (WB/IB) Protocol
- Immunohistochemistry (IHC) Protocol
- Immunocytochemistry (ICC) Protocol
- Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol
- Blocking Peptide Competition Protocol (BPCP)
- Immunoprecipitation (IP) Protocol
- Antibody Array (AA) Protocol
- Tips Information:
-
See our General FAQ page.
-
What is the species homology for "PPP3CC Antibody (OAAL00255)"?
The tested species reactivity for this item is "". This antibody is predicted to have homology to "Human, Mouse".
-
How long will it take to receive "PPP3CC Antibody (OAAL00255)"?
This item is available "Domestic: within 2-3 week delivery | International: 2-3 weeks".
-
What buffer format is "PPP3CC Antibody (OAAL00255)" provided in?
This item is provided in "Liquid".
Additional format options may be available. For more information please contact info@avivasysbio.com. -
What are other names for "PPP3CC Antibody (OAAL00255)"?
This target may also be called "calcineurin, testis-specific catalytic subunit;CALNA3;CAM-PRP catalytic subunit;CNA3;PP2Bgamma;protein phosphatase 3, catalytic subunit, gamma isozyme;serine/threonine-protein phosphatase 2B catalytic subunit gamma isoform." in publications.
-
What is the shipping cost for "PPP3CC Antibody (OAAL00255)"?
The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.
-
What is the guarantee for "PPP3CC Antibody (OAAL00255)"?
All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.
-
Can I get bulk pricing for "PPP3CC Antibody (OAAL00255)"?
You can get bulk pricing for this item by going here.
-
What is the molecular weight of the protein?
The molecular weight reported by Uniprot for this item is "".
Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics. -
What protocols are available for "PPP3CC Antibody (OAAL00255)"?
We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.
-
What are positive controls for "PPP3CC"?
We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.
-
What are negative controls for "PPP3CC"?
We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.
-
What other proteins interact with "PPP3CC"?
This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.
-
What biological processes are associated with "PPP3CC"?
This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.
-
What cellular components are associated with "PPP3CC"?
This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.
-
What protein functions are associated with "PPP3CC"?
This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.