PPP2R3B Antibody (OAAL00648)

Catalog No: OAAL00648

Size:100UG

Immunofluorescence of monoclonal antibody to PPP2R3B on HeLa cell. [antibody concentration 10 ug/ml]

Detection limit for recombinant GST tagged PPP2R3B is 0.3 ng/ml as a capture antibody.

Immunoprecipitation of PPP2R3B transfected lysate using anti-PPP2R3B monoclonal antibody and Protein A Magnetic Bead and immunoblotted with PPP2R3B MaxPab rabbit polyclonal antibody.

Product Info

• Predicted Species Reactivity: Human, Mouse
• Product Format: Liquid
• Clonality: Monoclonal
• Clone: 2E12
• Isotype: IgG2b Kappa
• Host: Mouse
• Application: Enzyme-linked immunosorbent assay|Immunofluorescence|Immunoprecipitation|Western blot
• Reconstitution and Storage: Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
• Immunogen: PPP2R3B (AAH11180, 1 a.a. ~ 225 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Peptide Sequence: MIDRIFSGAVTRGRKVQKEGKISYADFVWFLISEEDKKTPTSIEYWFRCMDLDGDGALSMFELEYFYEEQCRRLDSMAIEALPFQDCLCQMLDLVKPRTEGKITLQDLKRCKLANVFFDTFFNIEKYLDHEQKEQISLLRDGDSGGPELSDWEKYAAEEYDILVAEETAGEPWEDGFEAELSPVEQKLSALRSPLAQRPFFEAPSPLGAVDLYEYACGDEDLEPL
• Formulation: In 1x PBS, pH 7.4

Target Info

• Gene Symbol: PPP2R3B
• Gene Full Name: protein phosphatase 2 regulatory subunit B''beta
• Alias Symbols: NYREN8;NY-REN-8 antigen;PPP2R3L;PPP2R3LY;PR48;PR70;protein phosphatase 2 (formerly 2A), regulatory subunit B'', beta;protein phosphatase 2, regulatory subunit B'', beta;serine/threonine protein phosphatase 2A, 48kDa regulatory subunit B;serine/threonine-protein phosphatase 2A regulatory subunit B'' subunit beta.
• NCBI Gene Id: 28227
• Protein Name: Homo sapiens protein phosphatase 2 (formerly 2A), regulatory subunit B'', beta, mRNA (cDNA clone IMAGE:4150858), partial cds|PPP2R3B protein, partial [Homo sapiens]
• Description of Target: Protein phosphatase 2 (formerly named type 2A) is one of the four major Ser/Thr phosphatases and is implicated in the negative control of cell growth and division. Protein phosphatase 2 holoenzymes are heterotrimeric proteins composed of a structural subunit A, a catalytic subunit C, and a regulatory subunit B. The regulatory subunit is encoded by a diverse set of genes that have been grouped into the B/PR55, B'/PR61, and B''/PR72 families. These different regulatory subunits confer distinct enzymatic specificities and intracellular localizations to the holozenzyme. The product of this gene belongs to the B'' family. The B'' family has been further divided into subfamilies. The product of this gene belongs to the beta subfamily of regulatory subunit B''. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq
• Protein Accession #: https://www.ncbi.nlm.nih.gov/protein/AAH11180
• Nucleotide Accession #: https://www.ncbi.nlm.nih.gov/nuccore/BC011180