Catalog No: ARP42369_P050
Price: $0.00
SKU
ARP42369_P050
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.
Datasheets/ManualsPrintable datasheet for anti-PPP2R3B (ARP42369_P050) antibody
Product Info
Tested Species ReactivityHuman
Predicted Species ReactivityHuman
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceHuman: 100%
Peptide SequenceSynthetic peptide located within the following region: APHVRGTRRSAGTRVVQTRKEEPLPPATSQSIPTFYFPRGRPQDSVNVDA
Concentration0.5 mg/ml
Blocking PeptideFor anti-PPP2R3B (ARP42369_P050) antibody is Catalog # AAP42369
SubunitB''
Gene SymbolPPP2R3B
Gene Full NameProtein phosphatase 2, regulatory subunit B'', beta
Alias SymbolsPR48, PR70, NYREN8, PPP2R3L, PPP2R3LY
NCBI Gene Id28227
Protein NameSerine/threonine-protein phosphatase 2A regulatory subunit B'' subunit beta
Description of TargetProtein phosphatase 2 (formerly named type 2A) is one of the four major Ser/Thr phosphatases and is implicated in the negative control of cell growth and division. Protein phosphatase 2 holoenzymes are heterotrimeric proteins composed of a structural subunit A, a catalytic subunit C, and a regulatory subunit B. The regulatory subunit is encoded by a diverse set of genes that have been grouped into the B/PR55, B'/PR61, and B''/PR72 families. These different regulatory subunits confer distinct enzymatic specificities and intracellular localizations to the holozenzyme. PPP2R3B belongs to the B'' family. The B'' family has been further divided into subfamilies. PPP2R3B belongs to the beta subfamily of regulatory subunit B''.
Uniprot IDQ9Y5P8
Protein Accession #NP_037371
Nucleotide Accession #NM_013239
Protein Size (# AA)575
Molecular Weight65kDa
Protein InteractionsDUSP12; UBC; PPP2R1A; CDC6; PPP2R1B; PPP2CA;
  1. What is the species homology for "PPP2R3B Antibody - N-terminal region (ARP42369_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human".

  2. How long will it take to receive "PPP2R3B Antibody - N-terminal region (ARP42369_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "PPP2R3B Antibody - N-terminal region (ARP42369_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "PPP2R3B Antibody - N-terminal region (ARP42369_P050)"?

    This target may also be called "PR48, PR70, NYREN8, PPP2R3L, PPP2R3LY" in publications.

  5. What is the shipping cost for "PPP2R3B Antibody - N-terminal region (ARP42369_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "PPP2R3B Antibody - N-terminal region (ARP42369_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "PPP2R3B Antibody - N-terminal region (ARP42369_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "65kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "PPP2R3B Antibody - N-terminal region (ARP42369_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "PPP2R3B"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "PPP2R3B"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "PPP2R3B"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "PPP2R3B"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "PPP2R3B"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "PPP2R3B"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:PPP2R3B Antibody - N-terminal region (ARP42369_P050)
Your Rating
We found other products you might like!