Aviva Systems Biology will be closed in observance of Good Friday 3/29/2024. If you are in need of any assistance please email info@avivasysbio.com

Catalog No: ARP84802_P050
Price: $0.00
SKU
ARP84802_P050
Availability: Domestic: within 24 hours delivery | International: 3-5 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.
Datasheets/ManualsPrintable datasheet for anti-PPP2R2B (ARP84802_P050) antibody
Product Info
Tested Species ReactivityHuman
Predicted Species ReactivityHuman
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of human PPP2R2B
PurificationAffinity purified
Peptide SequenceSynthetic peptide located within the following region: STNDKTVKLWKVSERDKRPEGYNLKDEEGRLRDPATITTLRVPVLRPMDL
Concentration0.5 mg/ml
Blocking PeptideFor anti-PPP2R2B (ARP84802_P050) antibody is Catalog # AAP84802
Gene SymbolPPP2R2B
Gene Full Nameprotein phosphatase 2 regulatory subunit B, beta
Alias SymbolsPR52B, SCA12, B55BETA, PR55BETA, PP2ABBETA, PP2APR55B, PR2ABBETA, PR55-BETA, PP2AB55BETA, PR2AB55BETA, PP2APR55BETA, PR2APR55BETA
NCBI Gene Id5521
Protein Nameserine/threonine-protein phosphatase 2A 55 kDa regulatory subunit B beta isoform
Description of TargetThe product of this gene belongs to the phosphatase 2 regulatory subunit B family. Protein phosphatase 2 is one of the four major Ser/Thr phosphatases, and it is implicated in the negative control of cell growth and division. It consists of a common heteromeric core enzyme, which is composed of a catalytic subunit and a constant regulatory subunit, that associates with a variety of regulatory subunits. The B regulatory subunit might modulate substrate selectivity and catalytic activity. This gene encodes a beta isoform of the regulatory subunit B55 subfamily. Defects in this gene cause autosomal dominant spinocerebellar ataxia 12 (SCA12), a disease caused by degeneration of the cerebellum, sometimes involving the brainstem and spinal cord, and in resulting in poor coordination of speech and body movements. Multiple alternatively spliced variants, which encode different isoforms, have been identified for this gene. The 5' UTR of some of these variants includes a CAG trinucleotide repeat sequence (7-28 copies) that can be expanded to 55-78 copies in cases of SCA12.
Uniprot IDQ00005-7
Protein Accession #NP_001258828.1
Nucleotide Accession #NM_001271899.1
Protein Size (# AA)549
Molecular Weight60 kDa
  1. What is the species homology for "PPP2R2B Antibody - middle region (ARP84802_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human".

  2. How long will it take to receive "PPP2R2B Antibody - middle region (ARP84802_P050)"?

    This item is available "Domestic: within 24 hours delivery | International: 3-5 days".

  3. What buffer format is "PPP2R2B Antibody - middle region (ARP84802_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "PPP2R2B Antibody - middle region (ARP84802_P050)"?

    This target may also be called "PR52B, SCA12, B55BETA, PR55BETA, PP2ABBETA, PP2APR55B, PR2ABBETA, PR55-BETA, PP2AB55BETA, PR2AB55BETA, PP2APR55BETA, PR2APR55BETA" in publications.

  5. What is the shipping cost for "PPP2R2B Antibody - middle region (ARP84802_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "PPP2R2B Antibody - middle region (ARP84802_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "PPP2R2B Antibody - middle region (ARP84802_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "60 kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "PPP2R2B Antibody - middle region (ARP84802_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "PPP2R2B"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "PPP2R2B"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "PPP2R2B"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "PPP2R2B"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "PPP2R2B"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "PPP2R2B"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:PPP2R2B Antibody - middle region (ARP84802_P050)
Your Rating
We found other products you might like!