SAVE NOW with 10% off all Recombinant Antibodies Shop Now

Catalog No: ARP62902_P050
Price: $0.00
SKU
ARP62902_P050
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.
Datasheets/ManualsPrintable datasheet for anti-PPP1R3C (ARP62902_P050) antibody
Product Info
Tested Species ReactivityHuman
Predicted Species ReactivityHuman, Dog, Horse, Pig, Rabbit
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceDog: 79%; Horse: 79%; Human: 100%; Pig: 79%; Rabbit: 79%
Peptide SequenceSynthetic peptide located within the following region: PPVKSFLGPYDEFQRRHFVNKLKPLKSCLNIKHKAKSQNDWKCSHNQAKK
Concentration0.5 mg/ml
Blocking PeptideFor anti-PPP1R3C (ARP62902_P050) antibody is Catalog # AAP62902
Subunit3C
Gene SymbolPPP1R3C
Gene Full NameProtein phosphatase 1, regulatory subunit 3C
Alias SymbolsPTG, PPP1R5
NCBI Gene Id5507
Protein NameProtein phosphatase 1 regulatory subunit 3C
Description of TargetProtein phosphatase-1 participates in the regulation of a wide variety of cellular functions by reversible protein phosphorylation. The ability of PP1 to regulate diverse functions resides in its capacity to interact with a variety of regulatory subunits that may target PP1 to specific subcellular locations, modulate its substrate specificity, and allow its activity to be responsive to extracellular signals. Several targeting subunits of PP1 have been identified, including PPP1R5, the glycogen-binding subunits PPP1R3 and PPP1R4, and the nuclear inhibitor of PP1.
Uniprot IDQ9UQK1
Protein Accession #NP_005389
Nucleotide Accession #NM_005398
Protein Size (# AA)317
Molecular Weight35kDa
Protein InteractionsPPP1CB; UBC; PPP1CC; APP; ELAVL1; PPP1CA; SGTA; NHLRC1; EPM2A;
  1. What is the species homology for "PPP1R3C Antibody - N-terminal region (ARP62902_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human, Dog, Horse, Pig, Rabbit".

  2. How long will it take to receive "PPP1R3C Antibody - N-terminal region (ARP62902_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "PPP1R3C Antibody - N-terminal region (ARP62902_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "PPP1R3C Antibody - N-terminal region (ARP62902_P050)"?

    This target may also be called "PTG, PPP1R5" in publications.

  5. What is the shipping cost for "PPP1R3C Antibody - N-terminal region (ARP62902_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "PPP1R3C Antibody - N-terminal region (ARP62902_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "PPP1R3C Antibody - N-terminal region (ARP62902_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "35kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "PPP1R3C Antibody - N-terminal region (ARP62902_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "PPP1R3C"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "PPP1R3C"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "PPP1R3C"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "PPP1R3C"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "PPP1R3C"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "PPP1R3C"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:PPP1R3C Antibody - N-terminal region (ARP62902_P050)
Your Rating
We found other products you might like!