PPIA Recombinant Protein (Escherichia coli O6:H1) (OPCA05280)

Catalog No: OPCA05280

Product Info

• Predicted Species Reactivity: Escherichia coli
• Product Format: Liquid or Lyophilized powder
• Additional Information: Species Specificity Detail: Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
• Reconstitution and Storage: -20°C or -80°C
• Formulation: Tris-base, 50% glycerol
• Purity: Greater than 85% as determined by SDS-PAGE.
• Peptide Sequence: AKGDPHVLLTTSAGNIELELDKQKAPVSVQNFVDYVNSGFYNNTTFHRVIPGFMIQGGGFTEQMQQKKPNPPIKNEADNGLRNTRGTIAMARTADKDSATSQFFINVADNAFLDHGQRDFGYAVFGKVVKGMDVADKISQVPTHDVGPYQNVPSKPVVILSAKVLP
• Protein Sequence: AKGDPHVLLTTSAGNIELELDKQKAPVSVQNFVDYVNSGFYNNTTFHRVIPGFMIQGGGFTEQMQQKKPNPPIKNEADNGLRNTRGTIAMARTADKDSATSQFFINVADNAFLDHGQRDFGYAVFGKVVKGMDVADKISQVPTHDVGPYQNVPSKPVVILSAKVLP
• Storage Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Source: E.coli
• Protein Range: 25-190 aa
• Tag: N-terminal 10xHis-SUMO-tagged and C-terminal Myc-tagged
• Reference: Extensive mosaic structure revealed by the complete genome sequence of uropathogenic Escherichia coli. Welch R.A., Burland V., Plunkett G. III, Redford P., Roesch P., Rasko D., Buckles E.L., Liou S.-R., Boutin A., Hackett J., Stroud D., Mayhew G.F., Rose D.J., Zhou S., Schwartz D.C., Perna N.T., Mobley H.L.T., Donnenberg M.S., Blattner F.R. Proc. Natl. Acad. Sci. U.S.A. 99:17020-17024(2002)

Target Info

• Gene Symbol: PPIA
• Alias Symbols: Cyclophilin A;Rotamase A.
• Protein Name: Peptidyl-prolyl cis-trans isomerase A
• Description of Target: PPIases accelerate the folding of proteins. It catalyzes the cis-trans isomerization of proline imidic peptide bonds in oligopeptides (By similarity).
• Uniprot ID: P0AFL4
• Protein Accession #: WP_000477225
• Nucleotide Accession #: NC_004431
• Protein Size (# AA): Recombinant
• Molecular Weight: 38.1 kDa