PPIA Recombinant Protein (Escherichia coli O157:H7) (OPCA04400)

Catalog No: OPCA04400

Product Info

• Predicted Species Reactivity: Escherichia coli
• Product Format: Liquid or Lyophilized powder
• Additional Information: Species Specificity Detail: Escherichia coli O157:H7
• Reconstitution and Storage: -20°C or -80°C
• Formulation: Tris-base, 50% glycerol
• Purity: Greater than 90% as determined by SDS-PAGE.
• Peptide Sequence: AKGDPHVLLTTSAGNIELELDKQKAPVSVQNFVDYVNSGFYNNTTFHRVIPGFMIQGGGFTEQMQQKKPNPPIKNEADNGLRNTRGTIAMARTADKDSATSQFFINVADNAFLDHGQRDFGYAVFGKVVKGMDVADKISQVPTHDVGPYQNVPSKPVVILSAKVLP
• Protein Sequence: AKGDPHVLLTTSAGNIELELDKQKAPVSVQNFVDYVNSGFYNNTTFHRVIPGFMIQGGGFTEQMQQKKPNPPIKNEADNGLRNTRGTIAMARTADKDSATSQFFINVADNAFLDHGQRDFGYAVFGKVVKGMDVADKISQVPTHDVGPYQNVPSKPVVILSAKVLP
• Storage Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Source: E.coli
• Protein Range: 25-190 aa
• Tag: N-terminal 6xHis-SUMO-tagged
• Reference: Complete genome sequence of enterohemorrhagic Escherichia coli O157:H7 and genomic comparison with a laboratory strain K-12.Hayashi T., Makino K., Ohnishi M., Kurokawa K., Ishii K., Yokoyama K., Han C.-G., Ohtsubo E., Nakayama K., Murata T., Tanaka M., Tobe T., Iida T., Takami H., Honda T., Sasakawa C., Ogasawara N., Yasunaga T. Shinagawa H.DNA Res. 8:11-22(2001).

Target Info

• Gene Symbol: ppiA
• Gene Full Name: peptidyl-prolyl cis-trans isomerase A
• Alias Symbols: Cyclophilin A;ECs_4214;peptidyl-prolyl cis-trans isomerase A;Rotamase A.
• NCBI Gene Id: 915930
• Protein Name: Peptidyl-prolyl cis-trans isomerase A
• Description of Target: PPIases accelerate the folding of proteins. It catalyzes the cis-trans isomerization of proline imidic peptide bonds in oligopeptides (By similarity).
• Uniprot ID: P0AFL5
• Protein Accession #: NP_312241
• Nucleotide Accession #: NC_002695
• Protein Size (# AA): Recombinant
• Molecular Weight: 34.1 kDa