Search Antibody, Protein, and ELISA Kit Solutions

PPARGC1B Antibody - N-terminal region (ARP88193_P050)

100 ul
$289.00
In Stock
Request Bulk Order Quote

Gene Symbol:
PPARGC1B
Official Gene Full Name:
PPARG coactivator 1 beta
NCBI Gene Id:
133522
Protein Name:
Peroxisome proliferator-activated receptor gamma coactivator 1-beta
Swissprot Id:
Q86YN6
Protein Accession #:
NP_001166169.1
Nucleotide Accession #:
NM_001172698.1
Alias Symbols:
PERC, ERRL1, PGC1B, PGC-1(beta)
Description of Target:
The protein encoded by this gene stimulates the activity of several transcription factors and nuclear receptors, including estrogen receptor alpha, nuclear respiratory factor 1, and glucocorticoid receptor. The encoded protein may be involved in fat oxidation, non-oxidative glucose metabolism, and the regulation of energy expenditure. This protein is downregulated in prediabetic and type 2 diabetes mellitus patients. Certain allelic variations in this gene increase the risk of the development of obesity. Three transcript variants encoding different isoforms have been found for this gene.
Protein Size (# AA):
1023
Molecular Weight:
112 kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity purified
Application:
WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express PPARGC1B.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express PPARGC1B.
Immunogen:
The immunogen is a synthetic peptide directed towards the N terminal region of human PPARGC1B
Predicted Species Reactivity:
Human
Tested Species Reactivity:
Human
Peptide Sequence:
Synthetic peptide located within the following region: LSQLDASDFDSATCFGELQWCPENSETEPNQYSPDDSELFQIDSENEALL
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide:
For anti-PPARGC1B (ARP88193_P050) antibody is Catalog # AAP88193
Datasheets/Manuals:
Printable datasheet for anti-PPARGC1B (ARP88193_P050) antibody

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...