Search Antibody, Protein, and ELISA Kit Solutions

PPARGC1A Antibody - N-terminal region (ARP31507_P050)

100 ul
$319.00
In Stock
Request Bulk Order Quote

Conjugation Options

ARP31507_P050-FITC Conjugated

ARP31507_P050-HRP Conjugated

ARP31507_P050-Biotin Conjugated

Gene Symbol:
PPARGC1A
Official Gene Full Name:
Peroxisome proliferator-activated receptor gamma, coactivator 1 alpha
NCBI Gene Id:
10891
Protein Name:
Peroxisome proliferator-activated receptor gamma coactivator 1-alpha
Swissprot Id:
Q9UBK2
Protein Accession #:
NP_037393
Nucleotide Accession #:
NM_013261
Alias Symbols:
LEM6, PGC-1(alpha), PGC-1v, PGC1, PGC1A, PPARGC1
Replacement Item:
This antibody may replace item sc-13067 from Santa Cruz Biotechnology.
Description of Target:
PPARGC1A is a transcriptional coactivator that regulates the genes involved in energy metabolism. This protein interacts with PPARgamma, which permits the interaction of this protein with multiple transcription factors. This protein can interact with, and regulate the activities of, cAMP response element binding protein (CREB) and nuclear respiratory factors (NRFs). It provides a direct link between external physiological stimuli and the regulation of mitochondrial biogenesis, and is a major factor that regulates muscle fiber type determination. This protein may be also involved in controlling blood pressure, regulating cellular cholesterol homoeostasis, and the development of obesity.The protein encoded by this gene is a transcriptional coactivator that regulates the genes involved in energy metabolism. This protein interacts with PPARgamma, which permits the interaction of this protein with multiple transcription factors. This protein can interact with, and regulate the activities of, cAMP response element binding protein (CREB) and nuclear respiratory factors (NRFs). It provides a direct link between external physiological stimuli and the regulation of mitochondrial biogenesis, and is a major factor that regulates muscle fiber type determination. This protein may be also involved in controlling blood pressure, regulating cellular cholesterol homoeostasis, and the development of obesity. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Protein Size (# AA):
798
Molecular Weight:
91kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity Purified
Application:
IF, WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express PPARGC1A.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express PPARGC1A.
Immunogen:
The immunogen is a synthetic peptide directed towards the N terminal region of human PPARGC1A
Predicted Species Reactivity:
Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Tested Species Reactivity:
Human, Mouse
Predicted Homology Based on Immunogen Sequence:
Cow: 93%; Dog: 100%; Goat: 93%; Guinea Pig: 100%; Horse: 93%; Human: 100%; Mouse: 93%; Rabbit: 93%; Rat: 100%; Zebrafish: 82%
Complete computational species homology data:
Anti-PPARGC1A (ARP31507_P050)
Peptide Sequence:
Synthetic peptide located within the following region: PSFDALTDGDVTTDNEASPSSMPDGTPPPQEAEEPSLLKKLLLAPANTQL
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
NRIP1; SUMO1; UBE2I; UBC; SIRT1; PPARG; PRKAA1; KAT2A; EGFR; CDK6; CAPNS1; PARK7; PIAS1; SFPQ; ESRRG; RNF2; TP53; HNF4A; CREBZF; NR3C1; ESRRA; RNF34; NR1I2; ESR2; BCL6; SF1; NR5A2; MYEF2; NCOA6; IQGAP1; MYOD1; EP300; LRPPRC; THRB; MYBBP1A; MED1; NR1I3; NC
Blocking Peptide:
For anti-PPARGC1A (ARP31507_P050) antibody is Catalog # AAP31507 (Previous Catalog # AAPP02269)
Datasheets/Manuals:
Printable datasheet for anti-PPARGC1A (ARP31507_P050) antibody
Target Reference:
Vimaleswaran,K.S., (er) J. Appl. Physiol. (2008) In press
Publications:

Lee, Y. H. et al. Integrative toxicoproteomics implicates impaired mitochondrial glutathione import as an off-target effect of troglitazone. J. Proteome Res. 12, 2933-45 (2013). IF, WB, Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish 23659346

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...