- Toll Free: 888-880-0001
- Phone: 858-552-6979
- Email: info@avivasysbio.com
- $55: Antibody & Protein in US
- $55 + $25/Kit in US
- Contact us for international orders.
Datasheets/Manuals | Printable datasheet for anti-PPARG (OAAN00069) |
---|
Predicted Species Reactivity | Human, Mouse |
---|---|
Product Format | Liquid PBS with 0.02% sodium azide, 50% glycerol (pH 7.3) |
Clonality | Polyclonal |
Isotype | IgG |
Host | Rabbit |
Conjugation | Unconjugated |
Application | WB, IHC, IF |
:: | Positive Samples: SKOV3, THP-1, SW620, mouse kidney Cellular Location: Cytoplasm, Nucleus |
Reconstitution and Storage | Store at -20C. Avoid repeated freeze/thaw cycles. |
Immunogen | A synthetic peptide corresponding to a sequence within amino acids 50-150 of human PPARG (NP_056953.2). |
Purification | Affinity purified against immunogen |
Peptide Sequence | LSVMEDHSHSFDIKPFTTVDFSSISTPHYEDIPFTRTDPVVADYKYDLKLQEYQSAIKVEPASPPYYSEKTQLYNKPHEEPSNSLMAIECRVCGDKASGFH |
Application Info | WB: 1:500~2000 IHC: 1:50~200 IF: 1:50~200 |
Gene Symbol | PPARG |
---|---|
Gene Full Name | peroxisome proliferator activated receptor gamma |
Alias Symbols | GLM1, CIMT1, NR1C3, PPARG1, PPARG2, PPARG5, PPARgamma |
NCBI Gene Id | 5468 |
Protein Name | Peroxisome proliferator-activated receptor gamma |
Description of Target | This gene encodes a member of the peroxisome proliferator-activated receptor (PPAR) subfamily of nuclear receptors. PPARs form heterodimers with retinoid X receptors (RXRs) and these heterodimers regulate transcription of various genes. Three subtypes of PPARs are known: PPAR-alpha, PPAR-delta, and PPAR-gamma. The protein encoded by this gene is PPAR-gamma and is a regulator of adipocyte differentiation. Additionally, PPAR-gamma has been implicated in the pathology of numerous diseases including obesity, diabetes, atherosclerosis and cancer. Alternatively spliced transcript variants that encode different isoforms have been described. |
Uniprot ID | P37231 |
Protein Accession # | NP_005028.4 |
Nucleotide Accession # | NM_005037.5 |
Molecular Weight | 58 kDa |
- Protocol:
- Reconstitution & Storage Instructions
- Western Blotting/Immunoblotting (WB/IB) Protocol
- Immunohistochemistry (IHC) Protocol
- Immunocytochemistry (ICC) Protocol
- Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol
- Blocking Peptide Competition Protocol (BPCP)
- Immunoprecipitation (IP) Protocol
- Antibody Array (AA) Protocol
- Tips Information:
-
See our General FAQ page.
-
What is the species homology for "PPARG Antibody (OAAN00069)"?
The tested species reactivity for this item is "". This antibody is predicted to have homology to "Human, Mouse".
-
How long will it take to receive "PPARG Antibody (OAAN00069)"?
This item is available "Domestic: within 1-2 weeks delivery | International: 1-2 weeks".
-
What buffer format is "PPARG Antibody (OAAN00069)" provided in?
This item is provided in "Liquid PBS with 0.02% sodium azide, 50% glycerol (pH 7.3)".
Additional format options may be available. For more information please contact info@avivasysbio.com. -
What are other names for "PPARG Antibody (OAAN00069)"?
This target may also be called "GLM1, CIMT1, NR1C3, PPARG1, PPARG2, PPARG5, PPARgamma" in publications.
-
What is the shipping cost for "PPARG Antibody (OAAN00069)"?
The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.
-
What is the guarantee for "PPARG Antibody (OAAN00069)"?
All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.
-
Can I get bulk pricing for "PPARG Antibody (OAAN00069)"?
You can get bulk pricing for this item by going here.
-
What is the molecular weight of the protein?
The molecular weight reported by Uniprot for this item is "58 kDa".
Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics. -
What protocols are available for "PPARG Antibody (OAAN00069)"?
We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.
-
What are positive controls for "PPARG"?
We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.
-
What are negative controls for "PPARG"?
We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.
-
What other proteins interact with "PPARG"?
This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.
-
What biological processes are associated with "PPARG"?
This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.
-
What cellular components are associated with "PPARG"?
This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.
-
What protein functions are associated with "PPARG"?
This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.