Search Antibody, Protein, and ELISA Kit Solutions

PPARG Antibody - N-terminal region (ARP39207_T100)

100 ul
$229.00
In Stock
Request Bulk Order Quote

Conjugation Options

ARP39207_T100-FITC Conjugated

ARP39207_T100-HRP Conjugated

ARP39207_T100-Biotin Conjugated

Gene Symbol:
PPARG
Official Gene Full Name:
Peroxisome proliferator-activated receptor gamma
NCBI Gene Id:
5468
Protein Name:
Peroxisome proliferator-activated receptor gamma
Swissprot Id:
P37231
Protein Accession #:
NP_056953
Nucleotide Accession #:
NM_015869
Alias Symbols:
GLM1, CIMT1, NR1C3, PPARG1, PPARG2, PPARgamma
Replacement Item:
This antibody may replace item sc-110516 from Santa Cruz Biotechnology.
Description of Target:
PPARG is a regulator of adipocyte differentiation. Additionally, PPAR-gamma has been implicated in the pathology of numerous diseases including obesity, diabetes, atherosclerosis and cancer.The protein encoded by this gene is a member of the peroxisome pr
Protein Size (# AA):
505
Molecular Weight:
56kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Protein A purified
Application:
WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express PPARG.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express PPARG.
Immunogen:
The immunogen is a synthetic peptide directed towards the N terminal region of human PPARG
Predicted Species Reactivity:
Dog, Human, Pig
Tested Species Reactivity:
Human
Predicted Homology Based on Immunogen Sequence:
Dog: 79%; Human: 100%; Pig: 86%
Complete computational species homology data:
Anti-PPARG (ARP39207_T100)
Peptide Sequence:
Synthetic peptide located within the following region: MGETLGDSPIDPESDSFTDTLSANISQEMTMVDTEMPFWPTNFGISSVDL
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
HDAC3; NCOA1; NCOA3; SUMO1; UBC; SUMO2; RXRA; MED1; HMGA1; EP300; NCOA2; CDC34; PRKAA2; PRKAA1; PPARGC1A; ASH2L; RBBP5; NSD1; NCOA6; PAXIP1; MUC1; NR3C1; SMAD2; CREBBP; ALOX15B; ZFYVE9; USP7; NCOR1; CDK5; SMARCD3; SMARCA4; NEDD4; BCAS2; MIF4GD; MED14; JAZ
Blocking Peptide:
For anti-PPARG (ARP39207_T100) antibody is Catalog # AAP39207 (Previous Catalog # AAPY00819)
Datasheets/Manuals:
Printable datasheet for anti-PPARG (ARP39207_T100) antibody
Target Reference:
Wang,Y., et al., (2006) Fertil. Steril. 85 (5), 1536-1540

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...