PPARD Antibody - N-terminal region (ARP37889_T100)

Catalog No: ARP37889_T100

WB Suggested Anti-PPARD Antibody Titration: 0.3125ug/ml
ELISA Titer: 1:312500
Positive Control: SP2/0 cell lysate

Host: Rabbit
Target Name: PPARD
Sample Tissue: Mouse Brain
Antibody Dilution: 1ug/ml

Host: Mouse
Target Name: PPARD
Sample Tissue: Mouse Brain
Antibody Dilution: 1ug/ml

Product Info

• Tested Species Reactivity: Mouse
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of mouse PPARD
• Purification: Protein A purified
• Predicted Homology Based on Immunogen Sequence: Cow: 85%; Dog: 93%; Guinea Pig: 100%; Horse: 93%; Human: 93%; Mouse: 100%; Rabbit: 93%; Rat: 100%
• Peptide Sequence: Synthetic peptide located within the following region: FGRMPEAEKRKLVAGLTASEGCQHNPQLADLKAFSKHIYNAYLKNFNMTK
• Concentration: 1.0 mg/ml
• Blocking Peptide: For anti-PPARD (ARP37889_T100) antibody is Catalog # AAP37889 (Previous Catalog # AAPP20011)
• Reference: Nadra,K., et al., (2006) Mol. Cell. Biol. 26 (8), 3266-3281
• Publications:

  Ares-Carrasco, S. et al. Proteome changes in the myocardium of experimental chronic diabetes and hypertension: role of PPARa in the associated hypertrophy. J. Proteomics 75, 1816-29 (2012). 22234359

  Failure to up-regulate transcription of genes necessary for muscle adaptation underlies limb girdle muscular dystrophy 2A (calpainopathy). Hum. Mol. Genet. 25, 2194-2207 (2016). 27005420

  Predictive Role of Biopsy Based Biomarkers for Radiotherapy Treatment in Rectal Cancer. J Pers Med. 10, NULL (2020). 33066317

  Yang, L. et al. Biological function and prognostic significance of peroxisome proliferator-activated receptor d in rectal cancer. Clin. Cancer Res. 17, 3760-70 (2011). 21531809

  Yang, L. et al. Knockdown of peroxisome proliferator-activated receptor-beta induces less differentiation and enhances cell-fibronectin adhesion of colon cancer cells. Oncogene 29, 516-26 (2010). 19935699

• Description:
  View product citations for PPARD Antibody - N-terminal region (ARP37889_T100) on CiteAb

Target Info

• Gene Symbol: PPARD
• Gene Full Name: Peroxisome proliferator activator receptor delta
• Alias Symbols: P, NUC, Nr1, Ppa, NUC1, PPAR, NUC-1, Nr1c2, Pparb, PPAR[b], Pparb/d, PPAR-beta, PPARdelta, PPAR-delta
• NCBI Gene Id: 19015
• Protein Name: Peroxisome proliferator-activated receptor delta
• Description of Target: PPARdelta is pivotal to control the program for fatty acid oxidation in the skeletal muscle, thereby ameliorating obesity and insulin resistance through its activation in obese animals.
• Uniprot ID: P35396
• Protein Accession #: NP_035275
• Nucleotide Accession #: NM_011145
• Protein Size (# AA): 440
• Molecular Weight: 48kDa
• Protein Interactions: Scand1; HDAC7; NCOR2; BCL6; HSP90AA1; Apc; Rxrg; Rxra; Dut; GADD45A;