Size:100 ul
Special Price $229.00 Regular Price $289.00
In Stock
SKU
P100858_P050
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

P100858_P050-FITC Conjugated

P100858_P050-HRP Conjugated

P100858_P050-Biotin Conjugated

POU3F2 Antibody - C-terminal region (P100858_P050)

Catalog#: P100858_P050
Domestic: within 1-2 days delivery | International: 1-2 days
More Information
Tested Species Reactivity Human
Predicted Species Reactivity Cow, Human, Pig, Rat
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality Polyclonal
Host Rabbit
Application WB
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item This antibody may replace item sc-31983 from Santa Cruz Biotechnology.
Immunogen The immunogen is a synthetic peptide directed towards the C terminal region of human POU3F2
Purification Affinity Purified
Predicted Homology Based on Immunogen Sequence Cow: 100%; Human: 100%; Pig: 100%; Rat: 100%
Complete computational species homology data Anti-POU3F2 (P100858_P050)
Peptide Sequence Synthetic peptide located within the following region: QLEKEVVRVWFCNRRQKEKRMTPPGGTLPGAEDVYGGSRDTPPHHGVQTP
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide For anti-POU3F2 (P100858_P050) antibody is Catalog # AAP31219 (Previous Catalog # AAPP01964)
Datasheets/Manuals Printable datasheet for anti-POU3F2 (P100858_P050) antibody
Target Reference Goodall,J., (2004) Mol. Cell. Biol. 24 (7), 2923-2931
Gene Symbol POU3F2
Official Gene Full Name POU class 3 homeobox 2
Alias Symbols BRN2, OCT7, OTF7, OTF-7, POUF3, brn-2, oct-7
NCBI Gene Id 5454
Protein Name POU domain, class 3, transcription factor 2
Description of Target N-Oct-3 (POU3F2) is a protein belonging to a large family of transcription factors that bind to the octameric DNA sequence ATGCAAAT. Most of these proteins share a highly homologous region, referred to as the POU domain, which occurs in several mammalian transcription factors, including the octamer-binding proteins Oct1 (POU2F1) and Oct2 (POU2F2), and the pituitary protein Pit1 (PIT1). Class III POU genes are expressed predominantly in the CNS. It is likely that CNS-specific transcription factors such as these play an important role in mammalian neurogenesis by regulating their diverse patterns of gene expression. N-Oct-3 is a protein belonging to a large family of transcription factors that bind to the octameric DNA sequence ATGCAAAT. Most of these proteins share a highly homologous region, referred to as the POU domain, which occurs in several mammalian transcription factors, including the octamer-binding proteins Oct1 (POU2F1; MIM 164175) and Oct2 (POU2F2; MIM 164176), and the pituitary protein Pit1 (PIT1; MIM 173110). Class III POU genes are expressed predominantly in the CNS. It is likely that CNS-specific transcription factors such as these play an important role in mammalian neurogenesis by regulating their diverse patterns of gene expression.[supplied by OMIM].
Swissprot Id P20265
Protein Accession # NP_005595
Nucleotide Accession # NM_005604
Protein Size (# AA) 443
Molecular Weight 47kDa
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express POU3F2.
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express POU3F2.
Protein Interactions UBC; TBP; SOX10; POU3F2; PAX3; GTF2B; EP300; SOX11; PQBP1; POU3F4;
  1. What is the species homology for "POU3F2 Antibody - C-terminal region (P100858_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Cow, Human, Pig, Rat".

  2. How long will it take to receive "POU3F2 Antibody - C-terminal region (P100858_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "POU3F2 Antibody - C-terminal region (P100858_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "POU3F2 Antibody - C-terminal region (P100858_P050)"?

    This target may also be called "BRN2, OCT7, OTF7, OTF-7, POUF3, brn-2, oct-7" in publications.

  5. What is the shipping cost for "POU3F2 Antibody - C-terminal region (P100858_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "POU3F2 Antibody - C-terminal region (P100858_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "POU3F2 Antibody - C-terminal region (P100858_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "47kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "POU3F2 Antibody - C-terminal region (P100858_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data tab on the product page.

  10. What are positive controls for "POU3F2"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "POU3F2"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "POU3F2"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "POU3F2"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "POU3F2"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "POU3F2"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:POU3F2 Antibody - C-terminal region (P100858_P050)
Your Rating
We found other products you might like!