Search Antibody, Protein, and ELISA Kit Solutions

POU3F2 Antibody - C-terminal region (P100858_P050)

100 ul
$289.00
In Stock
Request Bulk Order Quote

Conjugation Options

P100858_P050-FITC Conjugated

P100858_P050-HRP Conjugated

P100858_P050-Biotin Conjugated

Gene Symbol:
POU3F2
Official Gene Full Name:
POU class 3 homeobox 2
NCBI Gene Id:
5454
Protein Name:
POU domain, class 3, transcription factor 2
Swissprot Id:
P20265
Protein Accession #:
NP_005595
Nucleotide Accession #:
NM_005604
Alias Symbols:
BRN2, OCT7, OTF7, OTF-7, POUF3, brn-2, oct-7
Replacement Item:
This antibody may replace item sc-31983 from Santa Cruz Biotechnology.
Description of Target:
N-Oct-3 (POU3F2) is a protein belonging to a large family of transcription factors that bind to the octameric DNA sequence ATGCAAAT. Most of these proteins share a highly homologous region, referred to as the POU domain, which occurs in several mammalian transcription factors, including the octamer-binding proteins Oct1 (POU2F1) and Oct2 (POU2F2), and the pituitary protein Pit1 (PIT1). Class III POU genes are expressed predominantly in the CNS. It is likely that CNS-specific transcription factors such as these play an important role in mammalian neurogenesis by regulating their diverse patterns of gene expression. N-Oct-3 is a protein belonging to a large family of transcription factors that bind to the octameric DNA sequence ATGCAAAT. Most of these proteins share a highly homologous region, referred to as the POU domain, which occurs in several mammalian transcription factors, including the octamer-binding proteins Oct1 (POU2F1; MIM 164175) and Oct2 (POU2F2; MIM 164176), and the pituitary protein Pit1 (PIT1; MIM 173110). Class III POU genes are expressed predominantly in the CNS. It is likely that CNS-specific transcription factors such as these play an important role in mammalian neurogenesis by regulating their diverse patterns of gene expression.[supplied by OMIM].
Protein Size (# AA):
443
Molecular Weight:
47kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity Purified
Application:
WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express POU3F2.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express POU3F2.
Immunogen:
The immunogen is a synthetic peptide directed towards the C terminal region of human POU3F2
Predicted Species Reactivity:
Cow, Human, Pig, Rat
Tested Species Reactivity:
Human
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Human: 100%; Pig: 100%; Rat: 100%
Complete computational species homology data:
Anti-POU3F2 (P100858_P050)
Peptide Sequence:
Synthetic peptide located within the following region: QLEKEVVRVWFCNRRQKEKRMTPPGGTLPGAEDVYGGSRDTPPHHGVQTP
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
UBC; TBP; SOX10; POU3F2; PAX3; GTF2B; EP300; SOX11; PQBP1; POU3F4;
Blocking Peptide:
For anti-POU3F2 (P100858_P050) antibody is Catalog # AAP31219 (Previous Catalog # AAPP01964)
Datasheets/Manuals:
Printable datasheet for anti-POU3F2 (P100858_P050) antibody
Target Reference:
Goodall,J., (2004) Mol. Cell. Biol. 24 (7), 2923-2931

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...