POU3F2 Antibody - C-terminal region : HRP (P100858_P050-HRP)

Catalog No: P100858_P050-HRP

Size:100ul

Product Info

• Predicted Species Reactivity: Human, Rat, Cow, Pig
• Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
• Clonality: Polyclonal
• Host: Rabbit
• Conjugation: HRP: Horseradish Peroxidase
• Application: WB
• Reconstitution and Storage: All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human POU3F2
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Human: 100%; Pig: 100%; Rat: 100%
• Peptide Sequence: Synthetic peptide located within the following region: QLEKEVVRVWFCNRRQKEKRMTPPGGTLPGAEDVYGGSRDTPPHHGVQTP
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-POU3F2 (P100858_P050-HRP) antibody is Catalog # AAP31219 (Previous Catalog # AAPP01964)
• Reference: Goodall,J., (2004) Mol. Cell. Biol. 24 (7), 2923-2931

Target Info

• Gene Symbol: POU3F2
• Gene Full Name: POU class 3 homeobox 2
• Alias Symbols: BRN2, OCT7, OTF7, OTF-7, POUF3, brn-2, oct-7, N-Oct3
• NCBI Gene Id: 5454
• Protein Name: POU domain, class 3, transcription factor 2
• Description of Target: N-Oct-3 (POU3F2) is a protein belonging to a large family of transcription factors that bind to the octameric DNA sequence ATGCAAAT. Most of these proteins share a highly homologous region, referred to as the POU domain, which occurs in several mammalian transcription factors, including the octamer-binding proteins Oct1 (POU2F1) and Oct2 (POU2F2), and the pituitary protein Pit1 (PIT1). Class III POU genes are expressed predominantly in the CNS. It is likely that CNS-specific transcription factors such as these play an important role in mammalian neurogenesis by regulating their diverse patterns of gene expression. N-Oct-3 is a protein belonging to a large family of transcription factors that bind to the octameric DNA sequence ATGCAAAT. Most of these proteins share a highly homologous region, referred to as the POU domain, which occurs in several mammalian transcription factors, including the octamer-binding proteins Oct1 (POU2F1; MIM 164175) and Oct2 (POU2F2; MIM 164176), and the pituitary protein Pit1 (PIT1; MIM 173110). Class III POU genes are expressed predominantly in the CNS. It is likely that CNS-specific transcription factors such as these play an important role in mammalian neurogenesis by regulating their diverse patterns of gene expression.[supplied by OMIM].
• Uniprot ID: P20265
• Protein Accession #: NP_005595
• Nucleotide Accession #: NM_005604
• Protein Size (# AA): 443
• Molecular Weight: 47kDa
• Protein Interactions: UBC; TBP; SOX10; POU3F2; PAX3; GTF2B; EP300; SOX11; PQBP1; POU3F4;