Catalog No: ARP31419_P050-HRP
Size:100ul
Price: $434.00
SKU
ARP31419_P050-HRP
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.

POU1F1 Antibody - C-terminal region : HRP (ARP31419_P050-HRP)

Click here to learn more about Aviva's By-Request Conjugation Service.
Datasheets/ManualsPrintable datasheet for anti-POU1F1 (ARP31419_P050-HRP) antibody
Product Info
Predicted Species ReactivityHuman, Mouse, Rat, Cow, Dog, Goat, Guinea Pig, Horse, Rabbit, Sheep, Zebrafish
Product FormatLiquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
ClonalityPolyclonal
HostRabbit
ConjugationHRP: Horseradish Peroxidase
ApplicationIHC, WB
Reconstitution and StorageAll conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
ImmunogenThe immunogen is a synthetic peptide directed towards the C terminal region of human POU1F1
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 100%; Dog: 100%; Goat: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Sheep: 100%; Zebrafish: 86%
Peptide SequenceSynthetic peptide located within the following region: QEIMRMAEELNLEKEVVRVWFCNRRQREKRVKTSLNQSLFSISKEHLECR
Concentration0.5 mg/ml
Blocking PeptideFor anti-POU1F1 (ARP31419_P050-HRP) antibody is Catalog # AAP31419 (Previous Catalog # AAPP03105)
ReferenceDattani,M.T., et al., (2003) GrowthHorm.IGFRes.16(9),1207-1209
Publications

Tennant, D. A. & Gottlieb, E. HIF prolyl hydroxylase-3 mediates alpha-ketoglutarate-induced apoptosis and tumor suppression. J. Mol. Med. (Berl). 88, 839-49 (2010). WB, Bovine, Goat, Pig, Dog, Mouse, Rat, Horse, Rabbit, Guinea pig, Human, Sheep, Zebrafish 20383689

Gene SymbolPOU1F1
Gene Full NamePOU class 1 homeobox 1
Alias SymbolsPIT1, CPHD1, GHF-1, Pit-1, POU1F1a
NCBI Gene Id5449
Protein NamePituitary-specific positive transcription factor 1
Description of TargetPIT1 is a pituitary-specific transcription factor responsible for pituitary development and hormone expression in mammals and is a member of the POU family of transcription factors that regulate mammalian development. The POU family is so named because the first 3 members identified were PIT1 and OCT1 of mammals, and Unc-86 of C. elegans. PIT1 contains 2 protein domains, termed POU-specific and POU-homeo, which are both necessary for high affinity DNA binding on genes encoding growth hormone and prolactin. PIT1 is also important for regulation of the genes encoding prolactin and thyroid-stimulating hormone beta subunit by thyrotropin-releasing hormone and cyclic AMP.
Uniprot IDP28069
Protein Accession #NP_000297
Nucleotide Accession #NM_000306
Protein Size (# AA)291
Molecular Weight33kDa
Protein InteractionsCEBPD; NCOR1; CREBBP; MED1; GATA2; NR1I3; NR1I2; PITX1; JUN; ETS1; NR3C1; VDR; PPARG; PPARA;
  1. What is the species homology for "POU1F1 Antibody - C-terminal region : HRP (ARP31419_P050-HRP)"?

    The tested species reactivity for this item is "". This antibody is predicted to have homology to "Human, Mouse, Rat, Cow, Dog, Goat, Guinea Pig, Horse, Rabbit, Sheep, Zebrafish".

  2. How long will it take to receive "POU1F1 Antibody - C-terminal region : HRP (ARP31419_P050-HRP)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "POU1F1 Antibody - C-terminal region : HRP (ARP31419_P050-HRP)" provided in?

    This item is provided in "Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "POU1F1 Antibody - C-terminal region : HRP (ARP31419_P050-HRP)"?

    This target may also be called "PIT1, CPHD1, GHF-1, Pit-1, POU1F1a" in publications.

  5. What is the shipping cost for "POU1F1 Antibody - C-terminal region : HRP (ARP31419_P050-HRP)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "POU1F1 Antibody - C-terminal region : HRP (ARP31419_P050-HRP)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "POU1F1 Antibody - C-terminal region : HRP (ARP31419_P050-HRP)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "33kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "POU1F1 Antibody - C-terminal region : HRP (ARP31419_P050-HRP)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "POU1F1"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "POU1F1"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "POU1F1"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "POU1F1"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "POU1F1"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "POU1F1"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:POU1F1 Antibody - C-terminal region : HRP (ARP31419_P050-HRP)
Your Rating
We found other products you might like!