POTASSIUM CHANNEL TOXIN ALPHA-KTX 23.1 Recombinant Protein (Scorpion) (OPCA05443)

Catalog No: OPCA05443

Product Info

• Predicted Species Reactivity: Vaejovis mexicanus
• Product Format: Liquid or Lyophilized powder
• Additional Information: Species Specificity Detail: Vaejovis mexicanus smithi (Scorpion) (Vaejovis smithi)
• Reconstitution and Storage: -20°C or -80°C
• Formulation: Tris-base, 50% glycerol
• Purity: Greater than 90% as determined by SDS-PAGE.
• Peptide Sequence: AAAISCVGSPECPPKCRAQGCKNGKCMNRKCKCYYC
• Protein Sequence: AAAISCVGSPECPPKCRAQGCKNGKCMNRKCKCYYC
• Storage Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Source: Mammalian Cells
• Protein Range: 1-36 aa
• Tag: N-terminal 10xHis-tagged and C-terminal Myc-tagged

Target Info

• Reference: Structure, function, and chemical synthesis of vaejovis mexicanus peptide 24: a novel potent blocker of Kv1.3 potassium channels of human T lymphocytes. Gurrola G.B., Hernandez-Lopez R.A., Rodriguez de la Vega R.C., Varga Z., Batista C.V.F., Salas-Castillo S.P., Panyi G., del Rio-Portilla F., Possani L.D. Biochemistry 51:4049-4061(2012)
• Alias Symbols: Toxin alpha-KTx 21.1, Toxin Vm24.
• Protein Name: Potassium channel toxin alpha-KTx 23.1
• Description of Target: Selectively and irreversibly binds (K(d)=2.9 pM) and blocks hKv1.3/KCNA3 potassium channels of human T-lymphocytes. Weakly blocks hKCa3.1/KCNN4, mKv1.1/KCNA1, and hKv1.2/KCNA2 channels. In vivo, high doses (200 ug) produce no symptoms of intoxication when injected into mice.
• Uniprot ID: P0DJ31
• Protein Size (# AA): Full Length
• Molecular Weight: 7.9 kDa