PORCN Antibody - N-terminal region : FITC (ARP49762_P050-FITC)

Catalog No: ARP49762_P050-FITC

Size:100ul

Product Info

• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.
• Clonality: Polyclonal
• Host: Rabbit
• Conjugation: FITC: Fluorescein Isothiocyanate
• Application: IHC, WB
• Reconstitution and Storage: All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human PORCN
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
• Peptide Sequence: Synthetic peptide located within the following region: ACRLLWRLGLPSYLKHASTVAGGFFSLYHFFQLHMVWVVLLSLLCYLVLF
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-PORCN (ARP49762_P050-FITC) antibody is Catalog # AAP49762 (Previous Catalog # AAPP29339)
• Reference: Chen,Z., (2008) Oncogene 27 (24), 3483-3488

Target Info

• Gene Symbol: PORCN
• Gene Full Name: Porcupine homolog (Drosophila)
• Alias Symbols: PPN, DHOF, FODH, MG61, PORC
• NCBI Gene Id: 64840
• Protein Name: Protein-cysteine N-palmitoyltransferase porcupine
• Description of Target: PORCN belongs to the evolutionarily conserved porcupine (Porc) gene family. Genes of the Porc family encode endoplasmic reticulum proteins with multiple transmembrane domains. Porcupine proteins are involved in the processing of Wnt (wingless and int homologue) proteins. Multiple alternatively spliced transcript variants encoding distinct isoforms have been observed.This gene belongs to the evolutionarily conserved porcupine (Porc) gene family. Genes of the Porc family encode endoplasmic reticulum proteins with multiple transmembrane domains. Porcupine proteins are involved in the processing of Wnt (wingless and int homologue) proteins. Multiple alternatively spliced transcript variants encoding distinct isoforms have been observed.
• Uniprot ID: Q9H237-4
• Protein Accession #: NP_073736
• Nucleotide Accession #: NM_022825
• Protein Size (# AA): 450
• Molecular Weight: 51kDa
• Protein Interactions: WNT5B; WNT3A; WNT6; WNT4; WNT7B; WNT1;