PONA Recombinant Protein (Slime mold) (OPCA04345)

Catalog No: OPCA04345

Product Info

• Predicted Species Reactivity: Dictyostelium discoideum
• Product Format: Liquid or Lyophilized powder
• Additional Information: Species Specificity Detail: Dictyostelium discoideum (Slime mold)
• Reconstitution and Storage: -20°C or -80°C
• Formulation: Tris-base, 50% glycerol
• Purity: Greater than 90% as determined by SDS-PAGE.
• Peptide Sequence: QYTLSVSNSASGSKCTTAVSAKLNACNTGCLNSFNIVESSNGKGLVFKTFINAACSGEYESLSQFTCAANQKIPTTSYIVSCNSTPSSNSTTDSDS
• Protein Sequence: QYTLSVSNSASGSKCTTAVSAKLNACNTGCLNSFNIVESSNGKGLVFKTFINAACSGEYESLSQFTCAANQKIPTTSYIVSCNSTPSSNSTTDSDS
• Storage Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Source: Yeast
• Protein Range: 23-118 aa
• Tag: N-terminal 6xHis-tagged
• Reference: F-actin affinity chromatography of detergent-solubilized plasma membranes: purification and initial characterization of ponticulin from Dictyostelium discoideum.Wuestehube L.J., Speicher D.W., Shariff A., Luna E.J.Methods Enzymol. 196:47-65(1991)

Target Info

• Gene Symbol: ponA
• Gene Full Name: actin binding protein
• Alias Symbols: DDB_0192061;DDB_0215380;DDB_G0293522;DDBDRAFT_0192061;DDBDRAFT_0215380.
• NCBI Gene Id: 8629357
• Protein Name: Ponticulin
• Description of Target: Binds F-actin and nucleates actin assembly. Major high affinity link between the plasma membrane and the cortical actin network.
• Uniprot ID: P54660
• Protein Accession #: XP_629065
• Nucleotide Accession #: XM_629063
• Protein Size (# AA): Recombinant
• Molecular Weight: 11.9 kDa