POMGNT2 Antibody - middle region (ARP48972_T100)

Catalog No: ARP48972_T100

Click here to learn more about Aviva's By-Request Conjugation Service.

WB Suggested Anti-C3orf39 Antibody Titration: 1.25ug/ml
Positive Control: HepG2 cell lysate

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human C3orf39
• Purification: Protein A purified
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
• Peptide Sequence: Synthetic peptide located within the following region: TTLFLPRGATVVELFPYAVNPDHYTPYKTLAMLPGMDLQYVAWRNMMPEN
• Concentration: 1.0 mg/ml
• Blocking Peptide: For anti-POMGNT2 (ARP48972_T100) antibody is Catalog # AAP48972 (Previous Catalog # AAPY02107)

Target Info

• Reference: Gerhard,D.S., Genome Res. 14 (10B), 2121-2127 (2004)
• Gene Symbol: POMGNT2
• Gene Full Name: protein O-linked mannose N-acetylglucosaminyltransferase 2 (beta 1,4-)
• Alias Symbols: AGO61, GTDC2, MDDGA8, MDDGC8, C3orf39
• NCBI Gene Id: 84892
• Protein Name: protein O-linked-mannose beta-1,4-N-acetylglucosaminyltransferase 2
• Description of Target: This gene encodes a protein with glycosyltransferase activity although its function is not currently known.
• Uniprot ID: Q8NAT1
• Protein Accession #: NP_116195
• Nucleotide Accession #: NM_032806
• Protein Size (# AA): 580
• Molecular Weight: 66kDa
• Protein Interactions: NOTCH2NL; FBXO6; APP;