POMC Antibody - middle region (ARP79668_P050)

Catalog No: ARP79668_P050

Host: Rabbit
Target Name: POMC
Sample Tissue: Human HCT15 Whole Cell lysates
Antibody Dilution: 1ug/ml

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human POMC
• Purification: Affinity purified
• Peptide Sequence: Synthetic peptide located within the following region: WCLESSQCQDLTTESNLLECIRACKPDLSAETPMFPGNGDEQPLTENPRK
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-POMC (ARP79668_P050) antibody is Catalog # AAP79668

Target Info

• Gene Symbol: POMC
• Gene Full Name: proopiomelanocortin
• Alias Symbols: LPH, MSH, NPP, POC, ACTH, CLIP, OBAIRH
• NCBI Gene Id: 5443
• Protein Name: pro-opiomelanocortin
• Description of Target: This gene encodes a preproprotein that undergoes extensive, tissue-specific, post-translational processing via cleavage by subtilisin-like enzymes known as prohormone convertases. There are eight potential cleavage sites within the preproprotein and, depending on tissue type and the available convertases, processing may yield as many as ten biologically active peptides involved in diverse cellular functions. The encoded protein is synthesized mainly in corticotroph cells of the anterior pituitary where four cleavage sites are used; adrenocorticotrophin, essential for normal steroidogenesis and the maintenance of normal adrenal weight, and lipotropin beta are the major end products. In other tissues, including the hypothalamus, placenta, and epithelium, all cleavage sites may be used, giving rise to peptides with roles in pain and energy homeostasis, melanocyte stimulation, and immune modulation. These include several distinct melanotropins, lipotropins, and endorphins that are contained within the adrenocorticotrophin and beta-lipotropin peptides. The antimicrobial melanotropin alpha peptide exhibits antibacterial and antifungal activity. Mutations in this gene have been associated with early onset obesity, adrenal insufficiency, and red hair pigmentation. Alternatively spliced transcript variants encoding the same protein have been described.
• Uniprot ID: P01189
• Protein Accession #: NP_000930.1
• Nucleotide Accession #: NM_000939.2
• Protein Size (# AA): 267
• Molecular Weight: 29 kDa