Catalog No: OPCA04789
Price: $0.00
SKU
OPCA04789
Availability: Domestic: Antibody & Kits: 2 weeks | Proteins: 4-6 weeks | International: Antibody & Kits: 2 weeks | Proteins: 4-6 weeks
Contact Us:
- Toll Free: 888-880-0001
- Phone: 858-552-6979
- Email: info@avivasysbio.com
Shipping Info:
- $55: Antibody & Protein in US
- $55 + $25/Kit in US
- Contact us for international orders.
Datasheets/Manuals | Printable datasheet for POLR1D Recombinant Protein (Human) (OPCA04789) (OPCA04789) |
---|
Predicted Species Reactivity | Homo sapiens|Human |
---|---|
Product Format | Liquid or Lyophilized powder |
Additional Information | Species Specificity Detail: Homo sapiens (Human) |
Reconstitution and Storage | -20°C or -80°C |
Formulation | Tris-base, 50% glycerol |
Purity | Greater than 90% as determined by SDS-PAGE. |
Peptide Sequence | MEEDQELERKISGLKTSMAEGERKTALEMVQAAGTDRHCVTFVLHEEDHTLGNSLRYMIMKNPEVEFCGYTTTHPSESKINLRIQTRGTLPAVEPFQRGLNELMNVCQHVLDKFEASIKDYKDQKASRNESTF |
Protein Sequence | MEEDQELERKISGLKTSMAEGERKTALEMVQAAGTDRHCVTFVLHEEDHTLGNSLRYMIMKNPEVEFCGYTTTHPSESKINLRIQTRGTLPAVEPFQRGLNELMNVCQHVLDKFEASIKDYKDQKASRNESTF |
Storage Buffer | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Source | E.coli |
Protein Range | 1-133 aa |
Tag | N-terminal GST-tagged |
Reference | Characterization of human RNA polymerase III identifies orthologues for Saccharomyces cerevisiae RNA polymerase III subunits. Hu P., Wu S., Sun Y., Yuan C.-C., Kobayashi R., Myers M.P., Hernandez N. Mol. Cell. Biol. 22:8044-8055(2002) |
Gene Symbol | POLR1D |
---|---|
Gene Full Name | RNA polymerase I and III subunit D |
Alias Symbols | AC19;DNA-directed RNA polymerase I subunit D;DNA-directed RNA polymerases I and III subunit RPAC2;hRPA19;POLR1C;polymerase (RNA) I polypeptide D, 16kDa;polymerase (RNA) I subunit D;Protein POLR1D;RNA polymerase I 16 kDa subunit;RNA polymerase I subunit D;RNA polymerases I and III subunit AC2;RPA16;RPA9;RPAC2;RPC16;RPO1-3;TCS2. |
NCBI Gene Id | 51082 |
Protein Name | DNA-directed RNA polymerases I and III subunit RPAC2|Protein POLR1D, isoform 2 |
Description of Target | DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates. Common core component of RNA polymerases I and III which synthesize ribosomal RNA precursors and small RNAs, such as 5S rRNA and tRNAs, respectively. |
Uniprot ID | Q9Y2S0 |
Protein Accession # | NP_001193488 |
Nucleotide Accession # | NM_001206559 |
Protein Size (# AA) | Recombinant |
Molecular Weight | 42.2 kDa |
- Protocol:
- Reconstitution & Storage Instructions
- Western Blotting/Immunoblotting (WB/IB) Protocol
- Immunohistochemistry (IHC) Protocol
- Immunocytochemistry (ICC) Protocol
- Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol
- Blocking Peptide Competition Protocol (BPCP)
- Immunoprecipitation (IP) Protocol
- Antibody Array (AA) Protocol
- Tips Information:
-
See our General FAQ page.
Write Your Own Review
We found other products you might like!