POLQ Antibody - C-terminal region : FITC (ARP49203_P050-FITC)

Catalog No: ARP49203_P050-FITC

Size:100ul

Click here to learn more about Aviva's By-Request Conjugation Service.

Product Info

• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.
• Clonality: Polyclonal
• Host: Rabbit
• Conjugation: FITC: Fluorescein Isothiocyanate
• Application: WB
• Reconstitution and Storage: All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human POLQ
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 93%; Dog: 93%; Guinea Pig: 86%; Horse: 93%; Human: 100%; Mouse: 93%; Rabbit: 86%; Rat: 100%
• Peptide Sequence: Synthetic peptide located within the following region: GHSFSFTSSDDIAEVLFLELKLPPNREMKNQGSKKTLGSTRRGIDNGRKL
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-POLQ (ARP49203_P050-FITC) antibody is Catalog # AAP49203 (Previous Catalog # AAPS24206)

Target Info

• Gene Symbol: POLQ
• Gene Full Name: Polymerase (DNA directed), theta
• Alias Symbols: PRO0327
• NCBI Gene Id: 10721
• Protein Name: DNA polymerase theta
• Description of Target: POLQ belongs to the DNA polymerase type-A family. POLQ could be involved in the repair of interstrand cross-links.
• Uniprot ID: O75417
• Protein Accession #: NP_955452.3
• Nucleotide Accession #: NM_199420.3
• Protein Size (# AA): 1762
• Molecular Weight: 180kDa
• Protein Interactions: AP2S1;