POLM Antibody - middle region (ARP54928_P050)

Catalog No: ARP54928_P050

Click here to learn more about Aviva's By-Request Conjugation Service.

WB Suggested Anti-POLM Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:1562500
Positive Control: Transfected 293T

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human POLM
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 79%; Dog: 92%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 86%; Pig: 100%; Rabbit: 86%; Rat: 93%
• Peptide Sequence: Synthetic peptide located within the following region: LRRFSRKEKGLWLNSHGLFDPEQKTFFQAASEEDIFRHLGLEYLPPEQRN
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-POLM (ARP54928_P050) antibody is Catalog # AAP54928 (Previous Catalog # AAPP31883)
• Reference: Juarez,R., (2006) Nucleic Acids Res. 34 (16), 4572-4582

Target Info

• Gene Symbol: POLM
• Gene Full Name: Polymerase (DNA directed), mu
• Alias Symbols: Tdt-N, Pol Mu
• NCBI Gene Id: 27434
• Protein Name: DNA-directed DNA/RNA polymerase mu
• Description of Target: POLM seems to act as an Ig mutase which is responsible for immunoglobulin (Ig) gene hypermutation.
• Uniprot ID: Q9NP87
• Protein Accession #: NP_037416
• Nucleotide Accession #: NM_013284
• Protein Size (# AA): 494
• Molecular Weight: 55kDa
• Protein Interactions: CEP55; IKZF3; PNMA1; PCNA; UBE2C; UBE2H; UBE2E1; UBE2D3; UBE2D2; UBE2D1;