PNPO Antibody - N-terminal region (ARP58515_P050)

Catalog No: ARP58515_P050

WB Suggested Anti-PNPO Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: Human Muscle

Rabbit Anti-PNPO antibody
Catalog Number: ARP58515
Formalin Fixed Paraffin Embedded Tissue: Human Liver
Primary antibody Concentration: 1:100
Secondary Antibody: Donkey anti-Rabbit-Cy3
Secondary Antibody Concentration: 1:200
Magnification: 20x
Exposure Time: 0.5-2.0sec

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human PNPO
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 86%; Dog: 93%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 93%; Rat: 100%
• Peptide Sequence: Synthetic peptide located within the following region: PMRKSYRGDREAFEETHLTSLDPVKQFAAWFEEAVQCPDIGEANAMCLAT
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-PNPO (ARP58515_P050) antibody is Catalog # AAP58515 (Previous Catalog # AAPP34535)
• Reference: Song,H., Schizophr. Res. 97 (1-3), 264-270 (2007)

Target Info

• Gene Symbol: PNPO
• Gene Full Name: Pyridoxamine 5'-phosphate oxidase
• Alias Symbols: PDXPO, HEL-S-302
• NCBI Gene Id: 55163
• Protein Name: Pyridoxine-5'-phosphate oxidase
• Description of Target: PNPO catalyzes the terminal, rate-limiting step in the synthesis of pyridoxal 5'-phosphate, also known as vitamin B6. Vitamin B6 is a required co-factor for enzymes involved in both homocysteine metabolism and synthesis of neurotransmitters such as catecholamine.Vitamin B6, or pyridoxal 5-prime-phosphate (PLP), is critical for normal cellular function, and some cancer cells have notable differences in vitamin B6 metabolism compared to their normal counterparts. The rate-limiting enzyme in vitamin B6 synthesis is pyridoxine-5-prime-phosphate (PNP) oxidase (PNPO; EC 1.4.3.5).[supplied by OMIM].
• Uniprot ID: Q9NVS9
• Protein Accession #: NP_060599
• Nucleotide Accession #: NM_018129
• Protein Size (# AA): 261
• Molecular Weight: 29kDa
• Protein Interactions: UBC; LPP; APP; ELAVL1;