SAVE NOW with 10% off all Recombinant Antibodies Shop Now

Catalog No: ARP56759_P050
Price: $0.00
SKU
ARP56759_P050
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.
Datasheets/ManualsPrintable datasheet for anti-PNPLA8 (ARP56759_P050) antibody
Product Info
Tested Species ReactivityHuman
Predicted Species ReactivityHuman, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of human PNPLA8
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 92%
Peptide SequenceSynthetic peptide located within the following region: IDNRTRALVQALRRTTDPKLCITRVEELTFHLLEFPEGKGVAVKERIIPY
Concentration0.5 mg/ml
Blocking PeptideFor anti-PNPLA8 (ARP56759_P050) antibody is Catalog # AAP56759 (Previous Catalog # AAPP39616)
Enhanced Validation
WBY
SPR
YCHAROS
ReferenceMungall,A.J., (2003) Nature 425 (6960), 805-811
Gene SymbolPNPLA8
Gene Full NamePatatin-like phospholipase domain containing 8
Alias SymbolsMMLA, IPLA2G, IPLA2-2, iPLA2gamma, PNPLA-gamma
NCBI Gene Id50640
Protein NameCalcium-independent phospholipase A2-gamma
Description of TargetPhospholipase A2 catalyzes cleavage of fatty acids from phospholipids, thereby regulating membrane physical properties and the release of lipid second messengers and growth factors. Phospholipase A2 activity also modulates cellular growth programs, inflam
Uniprot IDQ9NP80
Protein Accession #NP_056538
Nucleotide Accession #NM_015599
Protein Size (# AA)782
Molecular Weight88 kDa
Protein InteractionsUBC;
  1. What is the species homology for "PNPLA8 Antibody - middle region (ARP56759_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish".

  2. How long will it take to receive "PNPLA8 Antibody - middle region (ARP56759_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "PNPLA8 Antibody - middle region (ARP56759_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "PNPLA8 Antibody - middle region (ARP56759_P050)"?

    This target may also be called "MMLA, IPLA2G, IPLA2-2, iPLA2gamma, PNPLA-gamma" in publications.

  5. What is the shipping cost for "PNPLA8 Antibody - middle region (ARP56759_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "PNPLA8 Antibody - middle region (ARP56759_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "PNPLA8 Antibody - middle region (ARP56759_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "88 kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "PNPLA8 Antibody - middle region (ARP56759_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "PNPLA8"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "PNPLA8"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "PNPLA8"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "PNPLA8"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "PNPLA8"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "PNPLA8"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:PNPLA8 Antibody - middle region (ARP56759_P050)
Your Rating