Size:100 ul
$289.00
In Stock
SKU
ARP75005_P050-FITC
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP75005_P050 Unconjugated

ARP75005_P050-HRP Conjugated

ARP75005_P050-Biotin Conjugated

PNP Antibody - middle region : FITC (ARP75005_P050-FITC)

Catalog#: ARP75005_P050-FITC
Domestic: within 1-2 days delivery | International: 1-2 days
Click here to learn more about Aviva's By-Request Conjugation Service.
More Information
Predicted Species Reactivity Human
Product Format Liquid. Purified antibody supplied in 1x PBS buffer.
Clonality Polyclonal
Host Rabbit
Conjugation FITC (FAM): Excitation 495 nm/ Emission 520 nm
Application WB
Reconstitution and Storage All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Immunogen The immunogen is a synthetic peptide directed towards the middle region of Human PNPH
Purification Affinity purified
Peptide Sequence Synthetic peptide located within the following region: IMLIRDHINLPGFSGQNPLRGPNDERFGDRFPAMSDAYDRTMRQRALSTW
Concentration 0.5 mg/ml
Blocking Peptide For anti-PNP (ARP75005_P050-FITC) antibody is Catalog # AAP75005
Datasheets/Manuals Printable datasheet for anti-PNP (ARP75005_P050-FITC) antibody
Target Reference N/A
Gene Symbol PNP
Official Gene Full Name purine nucleoside phosphorylase
Alias Symbols NP, PUNP, PRO1837
NCBI Gene Id 4860
Protein Name purine nucleoside phosphorylase
Description of Target This gene encodes an enzyme which reversibly catalyzes the phosphorolysis of purine nucleosides. The enzyme is trimeric, containing three identical subunits. Mutations which result in nucleoside phosphorylase deficiency result in defective T-cell (cell-mediated) immunity but can also affect B-cell immunity and antibody responses. Neurologic disorders may also be apparent in patients with immune defects. A known polymorphism at aa position 51 that does not affect enzyme activity has been described. A pseudogene has been identified on chromosome 2.
Swissprot Id P00491
Protein Accession # NP_000261
Protein Size (# AA) 289
Molecular Weight 31kDa
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express PNP.
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express PNP.
Protein Interactions PNP; UBC; SUMO2; PPME1; SBDS; PSAT1; GMPS; RAB1A; PSMD5; MTAP; ENO2; HECW2; ITGA4; NADK2; TMEM177; DNAJB11; NDUFV1; GLO1; UBD; CDK2; SIRT7; UCHL5; LRIF1; CCDC90B; RBM48; ZHX1; TFB2M; NCALD; TFAM; TP53; APLP1;
  1. What is the species homology for "PNP Antibody - middle region : FITC (ARP75005_P050-FITC)"?

    The tested species reactivity for this item is "". This antibody is predicted to have homology to "Human".

  2. How long will it take to receive "PNP Antibody - middle region : FITC (ARP75005_P050-FITC)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "PNP Antibody - middle region : FITC (ARP75005_P050-FITC)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "PNP Antibody - middle region : FITC (ARP75005_P050-FITC)"?

    This target may also be called "NP, PUNP, PRO1837" in publications.

  5. What is the shipping cost for "PNP Antibody - middle region : FITC (ARP75005_P050-FITC)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "PNP Antibody - middle region : FITC (ARP75005_P050-FITC)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "PNP Antibody - middle region : FITC (ARP75005_P050-FITC)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "31kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "PNP Antibody - middle region : FITC (ARP75005_P050-FITC)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data tab on the product page.

  10. What are positive controls for "PNP"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "PNP"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "PNP"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "PNP"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "PNP"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "PNP"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:PNP Antibody - middle region : FITC (ARP75005_P050-FITC)
Your Rating