SAVE NOW with 10% off all Recombinant Antibodies Shop Now

Catalog No: ARP54945_P050
Price: $0.00
SKU
ARP54945_P050
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.

PNMA3 Antibody - N-terminal region (ARP54945_P050)

Click here to learn more about Aviva's By-Request Conjugation Service.
Datasheets/ManualsPrintable datasheet for anti-PNMA3 (ARP54945_P050) antibody
Product Info
Tested Species ReactivityHuman
Predicted Species ReactivityHuman, Rat, Horse
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human PNMA3
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceHorse: 93%; Human: 100%; Rat: 79%
Peptide SequenceSynthetic peptide located within the following region: QDIDYALLPREIPGKGGPWEVIVKPRNSDGEFLNRLNRFLEEERRTVSDM
Concentration0.5 mg/ml
Blocking PeptideFor anti-PNMA3 (ARP54945_P050) antibody is Catalog # AAP54945 (Previous Catalog # AAPP37203)
ReferenceWills,N.M., (2006) J. Biol. Chem. 281 (11), 7082-7088
Gene SymbolPNMA3
Gene Full NameParaneoplastic Ma antigen 3
Alias SymbolsMA3, MA5
NCBI Gene Id29944
Protein NameParaneoplastic antigen Ma3
Description of TargetThe specific function of the protein remains unknown.This gene is a member of the paraneoplastic antigen MA (PNMA) gene family, whose protein products share homology with retroviral Gag proteins. They are highly expressed in the brain and also in a range of tumors associated with serious neurological phenotypes. PMID:16407312 reports the presence of a functional -1 ribosomal frameshift signal (consisting of a heptanucleotide shift motif followed 3' by a pseudoknot structure) in this gene, however, the frame-shifted product has not been characterized.
Uniprot IDQ9UL41
Protein Accession #NP_037496
Nucleotide Accession #NM_013364
Protein Size (# AA)463
Molecular Weight52kDa
Protein InteractionsPARD6G;
  1. What is the species homology for "PNMA3 Antibody - N-terminal region (ARP54945_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human, Rat, Horse".

  2. How long will it take to receive "PNMA3 Antibody - N-terminal region (ARP54945_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "PNMA3 Antibody - N-terminal region (ARP54945_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "PNMA3 Antibody - N-terminal region (ARP54945_P050)"?

    This target may also be called "MA3, MA5" in publications.

  5. What is the shipping cost for "PNMA3 Antibody - N-terminal region (ARP54945_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "PNMA3 Antibody - N-terminal region (ARP54945_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "PNMA3 Antibody - N-terminal region (ARP54945_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "52kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "PNMA3 Antibody - N-terminal region (ARP54945_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "PNMA3"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "PNMA3"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "PNMA3"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "PNMA3"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "PNMA3"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "PNMA3"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:PNMA3 Antibody - N-terminal region (ARP54945_P050)
Your Rating
We found other products you might like!