Search Antibody, Protein, and ELISA Kit Solutions

PNMA2 Antibody - C-terminal region (ARP83002_P050)

100 ul
$289.00
In Stock
Request Bulk Order Quote

Gene Symbol:
PNMA2
Official Gene Full Name:
paraneoplastic Ma antigen 2
NCBI Gene Id:
10687
Protein Name:
paraneoplastic antigen Ma2
Swissprot Id:
Q9UL42
Protein Accession #:
NP_009188.1
Nucleotide Accession #:
NM_007257.5
Alias Symbols:
MA2, MM2, RGAG2
Description of Target:
Antibodies against PNMA2 are present in sera from patients suffering of paraneoplastic neurological disorders.
Protein Size (# AA):
364
Molecular Weight:
42 kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity purified
Application:
WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express PNMA2.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express PNMA2.
Immunogen:
The immunogen is a synthetic peptide directed towards the C terminal region of human PNMA2
Predicted Species Reactivity:
Human
Tested Species Reactivity:
Human
Peptide Sequence:
Synthetic peptide located within the following region: LKDQGPPPSFLELMKVIREEEEEEASFENESIEEPEERDGYGRWNHEGDD
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide:
For anti-PNMA2 (ARP83002_P050) antibody is Catalog # AAP83002
Datasheets/Manuals:
Printable datasheet for anti-PNMA2 (ARP83002_P050) antibody

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...